Crystal structure of unliganded SRA domain of mouse Np95. Determined by X-ray diffraction at 1.77 Å resolution. Released 9 Sept 2008.
Explore 2ZKG in 3D Show helices and sheets RCSB PDB PDBe
2ZKG contains 34 α-helices and 38 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 425-426 | 2 | |
| β-strand | 434-435 | 2 | 1 |
| α-helix | 438-443 | 6 | |
| β-strand | 454-457 | 4 | 1 |
| β-strand | 461-467 | 7 | 1 |
| β-strand | 476 | 1 | 1 |
| β-strand | 480-484 | 5 | 1 |
| α-helix | 508-515 | 8 | |
| β-strand | 526-527 | 2 | 1 |
| α-helix | 531-533 | 3 | |
| α-helix | 535-536 | 2 | |
| β-strand | 537-542 | 6 | 1 |
| α-helix | 543-547 | 5 | |
| β-strand | 557-572 | 16 | 1 |
| β-strand | 578-586 | 9 | 1 |
| α-helix | 591-592 | 2 | |
| α-helix | 596-605 | 10 | |
| β-strand | 609-610 | 2 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 425-426 | 2 | |
| β-strand | 434-435 | 2 | 2 |
| α-helix | 438-443 | 6 | |
| β-strand | 454-457 | 4 | 2 |
| β-strand | 461-467 | 7 | 2 |
| β-strand | 476 | 1 | 2 |
| β-strand | 480-484 | 5 | 2 |
| α-helix | 508-515 | 8 | |
| β-strand | 526-527 | 2 | 2 |
| α-helix | 531-533 | 3 | |
| α-helix | 535-536 | 2 | |
| β-strand | 537-542 | 6 | 2 |
| α-helix | 543-547 | 5 | |
| β-strand | 557-572 | 16 | 2 |
| β-strand | 578-586 | 9 | 2 |
| α-helix | 591-592 | 2 | |
| α-helix | 596-605 | 10 | |
| α-helix | 609 | 1 | |
| β-strand | 610 | 1 | 2 |
| α-helix | 611-612 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 425-426 | 2 | |
| β-strand | 434-435 | 2 | 3 |
| α-helix | 438-443 | 6 | |
| β-strand | 454-457 | 4 | 3 |
| β-strand | 461-467 | 7 | 3 |
| β-strand | 476 | 1 | 3 |
| β-strand | 480-484 | 5 | 3 |
| α-helix | 508-516 | 9 | |
| β-strand | 526-527 | 2 | 3 |
| α-helix | 531-533 | 3 | |
| α-helix | 535-536 | 2 | |
| β-strand | 537-542 | 6 | 3 |
| α-helix | 543-547 | 5 | |
| β-strand | 557-572 | 16 | 3 |
| β-strand | 578-586 | 9 | 3 |
| α-helix | 591-592 | 2 | |
| α-helix | 596-605 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 425-426 | 2 | |
| β-strand | 434-435 | 2 | 4 |
| α-helix | 438-444 | 7 | |
| β-strand | 454-457 | 4 | 4 |
| β-strand | 461-467 | 7 | 4 |
| β-strand | 476 | 1 | 4 |
| β-strand | 480-484 | 5 | 4 |
| α-helix | 508-515 | 8 | |
| β-strand | 526-527 | 2 | 4 |
| α-helix | 531-533 | 3 | |
| α-helix | 535-536 | 2 | |
| β-strand | 537-542 | 6 | 4 |
| α-helix | 543-547 | 5 | |
| β-strand | 557-572 | 16 | 4 |
| β-strand | 578-586 | 9 | 4 |
| α-helix | 591-592 | 2 | |
| α-helix | 596-605 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase UHRF1 | A, B, C, D | protein | 210 | Mus musculus | Q8VDF2 (AlphaFold model) |
>2ZKG_1 E3 ubiquitin-protein ligase UHRF1 (chains A, B, C, D) SGMACVGRTTECTIVPANHFGPIPGVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAY SLVLAGGYEDDVDNGNYFTYTGSGGRDLSGNKRTAGQSSDQKLTNNNRALALNCHSPINE KGAEAEDWRQGKPVRVVRNMKGGKHSKYAPAEGNRYDGIYKVVKYWPERGKSGFLVWRYL LRRDDTEPEPWTREGKDRTRQLGLTMQYPE
Recognition of hemi-methylated DNA by the SRA protein UHRF1 by a base-flipping mechanism. Arita, K., Ariyoshi, M., Tochio, H. et al. Nature (2008) 455:818-821. DOI 10.1038/nature07249 · PubMed
Other PDB entries of the same protein (UniProt Q8VDF2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2ZKG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.