2ZVW: Proliferating cell nuclear antigen 2

Crystal structure of Proliferating cell nuclear antigen 2 and Short peptide from human P21. Determined by X-ray diffraction at 2.5 Å resolution. Released 2 Jun 2009.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Arabidopsis thaliana
Chains: 16
Atoms: 16,590
Mol. weight: 265.58 kDa
Released: 2 Jun 2009

Explore 2ZVW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZVW contains 65 α-helices and 176 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
α-helix	9-22	14
β-strand	25-30	6	2
β-strand	34-40	7	2
β-strand	46-53	8	2
α-helix	54-56	3
β-strand	59-62	4	1
β-strand	66-71	6	2
α-helix	72-80	9
α-helix	86	1
β-strand	87-92	6	1
β-strand	98-104	7	1
β-strand	110-117	8	1
β-strand	135-140	6	2
α-helix	141-151	11
β-strand	157-163	7	3
β-strand	166-173	8	3
β-strand	176-182	7	3
α-helix	191-193	3
β-strand	196-199	4	2
β-strand	203-208	6	3
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	2
β-strand	235-241	7	2
β-strand	245-251	7	2
β-strand	254	1	3

Chain B: 6 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	4
α-helix	9-20	12
β-strand	25-31	7	5
β-strand	34-40	7	5
β-strand	46-53	8	5
α-helix	54-56	3
β-strand	59-62	4	4
β-strand	66-71	6	5
α-helix	72-79	8
β-strand	87-92	6	4
β-strand	98-104	7	4
β-strand	110-117	8	4
β-strand	119	1	5
β-strand	135-140	6	5
α-helix	141-152	12
β-strand	157-163	7	1
β-strand	166-173	8	1
β-strand	176-182	7	1
β-strand	196-199	4	5
β-strand	203-208	6	1
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	5
β-strand	235-241	7	5
β-strand	245-251	7	5
β-strand	254	1	1

Chain C: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	3
α-helix	9-19	11
β-strand	25-30	6	6
β-strand	34-40	7	6
β-strand	46-53	8	6
α-helix	54-56	3
β-strand	59-62	4	3
β-strand	66-71	6	6
α-helix	72-79	8
β-strand	87-92	6	3
β-strand	98-104	7	3
β-strand	110-117	8	3
β-strand	121-122	2	7
α-helix	123-126	4
β-strand	127	1	8
β-strand	135-140	6	6
α-helix	141-152	12
β-strand	157-163	7	4
β-strand	166-173	8	4
β-strand	176-182	7	4
β-strand	188	1	9
β-strand	196-199	4	6
β-strand	203-208	6	4
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	6
β-strand	235-241	7	6
β-strand	245-251	7	6
β-strand	254	1	10

Chain D: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	11
α-helix	9-19	11
β-strand	25-30	6	12
β-strand	34-40	7	12
β-strand	46-53	8	12
α-helix	54-56	3
β-strand	59-62	4	11
β-strand	66-71	6	12
α-helix	72-79	8
β-strand	87-92	6	11
β-strand	98-104	7	11
β-strand	110-117	8	11
β-strand	119	1	12
β-strand	135-140	6	12
α-helix	141-151	11
β-strand	157-163	7	13
β-strand	166-173	8	13
β-strand	176-182	7	13
α-helix	191-193	3
β-strand	196-199	4	12
β-strand	203-208	6	13
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	12
β-strand	235-241	7	12
β-strand	245-251	7	12
β-strand	254	1	14

Chain E: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	15
α-helix	10-19	10
β-strand	25-30	6	9
β-strand	34-40	7	9
β-strand	46-53	8	9
α-helix	54-56	3
β-strand	59-62	4	15
β-strand	66-71	6	9
α-helix	72-79	8
β-strand	87-92	6	15
β-strand	98-104	7	15
β-strand	110-117	8	15
β-strand	119	1	9
β-strand	120-121	2	16
β-strand	135-140	6	9
α-helix	141-151	11
β-strand	157-163	7	11
β-strand	166-173	8	11
β-strand	176-182	7	11
β-strand	188	1	6
α-helix	191-193	3
β-strand	196-199	4	9
β-strand	203-208	6	11
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	9
β-strand	235-241	7	9
β-strand	245-251	7	9
β-strand	254	1	17

Chain F: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	13
α-helix	10-19	10
β-strand	25-30	6	18
β-strand	34-40	7	18
β-strand	46-53	8	18
α-helix	54-56	3
β-strand	59-62	4	13
β-strand	66-71	6	18
α-helix	72-79	8
β-strand	87-92	6	13
β-strand	98-104	7	13
β-strand	110-117	8	13
β-strand	119	1	18
β-strand	135-140	6	18
α-helix	141-152	12
β-strand	157-163	7	15
β-strand	166-173	8	15
β-strand	176-182	7	15
α-helix	191-193	3
β-strand	196-199	4	18
β-strand	203-208	6	15
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	18
β-strand	235-241	7	18
β-strand	245-251	7	18
β-strand	254	1	15

Chain G: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	19
α-helix	10-20	11
β-strand	25-30	6	20
β-strand	34	1	21
β-strand	35-40	6	20
β-strand	46-52	7	20
β-strand	53	1	21
α-helix	54-56	3
β-strand	59-61	3	19
β-strand	66-71	6	20
α-helix	72-79	8
β-strand	87-92	6	19
β-strand	98-104	7	19
β-strand	111-117	7	19
β-strand	120-121	2	7
β-strand	127	1	22
α-helix	131-133	3
β-strand	135-140	6	20
α-helix	141-152	12
β-strand	157-163	7	23
β-strand	166-173	8	23
β-strand	176-182	7	23
β-strand	196-199	4	20
β-strand	203-208	6	23
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	20
β-strand	235-241	7	20
β-strand	245-251	7	20
β-strand	254	1	24

Chain H: 8 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	25
α-helix	9-19	11
β-strand	25-30	6	26
β-strand	34-40	7	26
β-strand	46-53	8	26
α-helix	54-56	3
β-strand	59-62	4	25
β-strand	66-71	6	26
α-helix	72-79	8
β-strand	87-92	6	25
β-strand	98-104	7	25
β-strand	111-117	7	25
β-strand	121-122	2	16
α-helix	125-127	3
β-strand	135-140	6	26
α-helix	141-152	12
β-strand	157-163	7	27
β-strand	166-173	8	27
β-strand	176-182	7	27
α-helix	191-193	3
β-strand	196-199	4	26
β-strand	203-208	6	27
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	26
β-strand	235-240	6	26
β-strand	245-251	7	26
β-strand	254	1	28

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proliferating cell nuclear antigen 2	A, B, C, D, E, F, G, H	protein	275	Arabidopsis thaliana	Q9ZW35 (AlphaFold model)
Cyclin-dependent kinase inhibitor 1	I, J, K, L, M, N, O, P	protein	22		P38936 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>2ZVW_1 Proliferating cell nuclear antigen 2 (chains A, B, C, D, E, F, G, H)
MGSSHHHHHHSSGLVPRGSHMLELRLVQGSLLKKVLEAVKDLVNDANFDCSTTGFSLQAM
DSSHVALVSLLLRSEGFEHYRCDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDGSDTVT
FMFESPTQDKIADFEMKLMDIDSEHLGIPDAEYHSIVRMPSGEFSRICKDLSSIGDTVVI
SVTKEGVKFSTAGDIGTANIVLRQNTTVDKPEDAIVIEMNEPVSLSFALRYMNSFTKATP
LSETVTISLSSELPVVVEYKVAEMGYIRYYLAPKI

Sequence of entity 2 (I, J, K, L, M, N, O, P), FASTA

>2ZVW_2 Cyclin-dependent kinase inhibitor 1 (chains I, J, K, L, M, N, O, P)
GRKRRQTSMTDFYHSKRRLIFS

Primary citation

Crystal structures of the Arabidopsis thaliana proliferating cell nuclear antigen 1 and 2 proteins complexed with the human p21 C-terminal segment. Strzalka, W., Oyama, T., Tori, K. et al. Protein Sci (2009) 18:1072-1080. DOI 10.1002/pro.117 · PubMed

Browse structure collections

About this viewer

MolViewer shows 2ZVW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.