3A8N: Tiam1 PHCCEx domain

Crystal structure of the Tiam1 PHCCEx domain. Determined by X-ray diffraction at 4.5 Å resolution. Released 24 Nov 2009.

Method: X-ray diffraction
Resolution: 4.5 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,142
Mol. weight: 31.62 kDa
Released: 24 Nov 2009

Explore 3A8N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3A8N contains 9 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	437-442	6	1
β-strand	443-446	4	2
β-strand	447-449	3	3
β-strand	453-455	3	3
α-helix	456-458	3
β-strand	463-468	6	1
β-strand	469-470	2	4
β-strand	473-474	2	4
β-strand	477	1	1
β-strand	496	1	4
β-strand	501-502	2	2
β-strand	517-519	3	2
β-strand	523-526	4	2
α-helix	532-553	22
α-helix	559-580	22
α-helix	582-588	7
α-helix	594-596	3
α-helix	600-624	25
α-helix	636-641	6
α-helix	645-650	6
α-helix	661-664	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-lymphoma invasion and metastasis-inducing protein 1	A	protein	279	Mus musculus	Q60610 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3A8N_1 T-lymphoma invasion and metastasis-inducing protein 1 (chains A)
GPLGSAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYETDGRS
GIDHNSVPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWITAIH
SACAAAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTILDQ
IFVWEQNLEQFQMDLFRFRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVSSFH
ALVAARTGEIGVRRRTQAMSRSASKRRSRFSSLWGLDTT

Primary citation

The PHCCEx domain of Tiam1/2 is a novel protein- and membrane-binding module. Terawaki, S., Kitano, K., Mori, T. et al. EMBO J (2010) 29:236-250. DOI 10.1038/emboj.2009.323 · PubMed

Other PDB entries of the same protein (UniProt Q60610 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FOE 2.8 Å, Crystal structure of RAC1 in complex with the guanine nucleotide exchange region of TIAM1
7UIR 3.1 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and Tiam1 in complex…
7UIQ 3.11 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and Tiam1

Browse structure collections

About this viewer

MolViewer shows 3A8N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.