Crystal Structure of Keap1 in Complex with Sequestosome-1/p62. Determined by X-ray diffraction at 2.8 Å resolution. Released 16 Mar 2010.
Explore 3ADE in 3D Show helices and sheets RCSB PDB PDBe
3ADE contains 6 α-helices and 40 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 326-331 | 6 | 1 |
| β-strand | 334-335 | 2 | 2 |
| β-strand | 337-338 | 2 | 2 |
| β-strand | 342-346 | 5 | 1 |
| β-strand | 351-355 | 5 | 1 |
| α-helix | 356-358 | 3 | |
| β-strand | 363 | 1 | 3 |
| β-strand | 366-370 | 5 | 4 |
| β-strand | 373-377 | 5 | 4 |
| β-strand | 380 | 1 | 3 |
| β-strand | 383 | 1 | 5 |
| β-strand | 386 | 1 | 5 |
| β-strand | 389 | 1 | 3 |
| β-strand | 393-397 | 5 | 4 |
| β-strand | 402-405 | 4 | 4 |
| α-helix | 407-409 | 3 | |
| β-strand | 414 | 1 | 6 |
| β-strand | 417-421 | 5 | 7 |
| β-strand | 424-428 | 5 | 7 |
| β-strand | 431-432 | 2 | 6 |
| β-strand | 435-436 | 2 | 6 |
| α-helix | 437 | 1 | |
| β-strand | 440-444 | 5 | 7 |
| β-strand | 449-453 | 5 | 7 |
| α-helix | 454-456 | 3 | |
| β-strand | 461 | 1 | 8 |
| β-strand | 464-468 | 5 | 8 |
| β-strand | 471-478 | 8 | 8 |
| β-strand | 483-491 | 9 | 8 |
| α-helix | 492-494 | 3 | |
| β-strand | 496-499 | 4 | 8 |
| β-strand | 508 | 1 | 9 |
| β-strand | 511-515 | 5 | 10 |
| β-strand | 518-522 | 5 | 10 |
| β-strand | 525 | 1 | 9 |
| β-strand | 530 | 1 | 9 |
| β-strand | 534-538 | 5 | 10 |
| β-strand | 543-546 | 4 | 10 |
| α-helix | 548-550 | 3 | |
| β-strand | 555 | 1 | 11 |
| β-strand | 558-561 | 4 | 11 |
| β-strand | 566-572 | 7 | 11 |
| β-strand | 577-585 | 9 | 11 |
| β-strand | 590-596 | 7 | 11 |
| β-strand | 602 | 1 | 2 |
| β-strand | 605-610 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Kelch-like ECH-associated protein 1 | A | protein | 318 | Mus musculus | Q9Z2X8 (AlphaFold model) |
| Sequestosome-1 | B | protein | 14 | Q64337 (AlphaFold model) |
>3ADE_1 Kelch-like ECH-associated protein 1 (chains A) MTLHKPTQAVPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSNGSWLRLADLQVPRSGLAG CVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCASMSVPRNRIGVGVIDGHIYA VGGSHGCIHHSSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSA ECYYPERNEWRMITPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFV APMRHHRSALGITVHQGKIYVLGGYDGHTFLDSVECYDPDSDTWSEVTRMTSGRSGVGVA VTMEPCRKQIDQQNCTCY
>3ADE_2 Sequestosome-1 (chains B) KEVDPSTGELQSLQ
The selective autophagy substrate p62 activates the stress responsive transcription factor Nrf2 through inactivation of Keap1. Komatsu, M., Kurokawa, H., Waguri, S. et al. Nat Cell Biol (2010) 12:213-223. DOI 10.1038/ncb2021 · PubMed
Other PDB entries of the same protein (UniProt Q9Z2X8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3ADE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.