Crystal Structure of VDR-LBD/22S-Butyl-1a,24R-dihydroxyvitamin D3 complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 31 Mar 2010.
Explore 3AFR in 3D Show helices and sheets RCSB PDB PDBe
3AFR contains 16 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 126-140 | 15 | |
| α-helix | 148-152 | 5 | |
| α-helix | 154-156 | 3 | |
| α-helix | 223-242 | 20 | |
| α-helix | 247-249 | 3 | |
| α-helix | 252-270 | 19 | |
| α-helix | 271-273 | 3 | |
| β-strand | 275-276 | 2 | 1 |
| β-strand | 281-283 | 3 | 1 |
| α-helix | 287-289 | 3 | |
| β-strand | 290-291 | 2 | 1 |
| α-helix | 293-297 | 5 | |
| α-helix | 303-317 | 15 | |
| α-helix | 323-334 | 12 | |
| α-helix | 345-366 | 22 | |
| α-helix | 375-400 | 26 | |
| α-helix | 404-407 | 4 | |
| α-helix | 412-418 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 628-634 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Vitamin D3 receptor | A | protein | 271 | Rattus norvegicus | P13053 (AlphaFold model) |
| 13-meric peptide from Mediator of RNA polymerase II transcription subunit 1 | C | protein | 13 | Xenopus tropicalis | A1L0Z0 (AlphaFold model) |
>3AFR_1 Vitamin D3 receptor (chains A) GSHMGSPNSPLKDSLRPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMDGSTGS VTLDLSPLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSN QSFTMDDMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKFQVGLKKLNLHEEEHVLLMAI CIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEE HSKQYRSLSFQPENSMKLTPLVLEVFGNEIS
>3AFR_2 13-meric peptide from Mediator of RNA polymerase II transcription subunit 1 (chains C) KNHPMLMNLLKDN
| ID | Name | Formula | Copies |
|---|---|---|---|
| ICJ | (1R,3S,5Z)-5-[(2E)-2-{(1R,3aS,7aR)-1-[(1R,2S,4R)-2-butyl-4-hydroxy-1,5-dimethyl… | C31 H52 O3 | 1 |
22S-Butyl-1alpha,24R-dihydroxyvitamin D(3): Recovery of vitamin D receptor agonistic activity. Inaba, Y., Nakabayashi, M., Itoh, T. et al. J Steroid Biochem Mol Biol (2010) 121:146-150. DOI 10.1016/j.jsbmb.2010.02.033 · PubMed
Other PDB entries of the same protein (UniProt P13053 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3AFR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.