3AI5: PDB entry 3AI5

Crystal structure of yeast enhanced green fluorescent protein-ubiquitin fusion protein. Determined by X-ray diffraction at 1.4 Å resolution. Released 29 Sept 2010.

Method: X-ray diffraction
Resolution: 1.4 Å
Organisms: Aequorea victoria, Mus musculus
Chains: 1
Atoms: 2,707
Mol. weight: 35.06 kDa
Released: 29 Sept 2010

Explore 3AI5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3AI5 contains 11 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
β-strand	11-22	12	1
β-strand	25-36	12	1
α-helix	37-39	3
β-strand	41-48	8	1
α-helix	57-60	4
α-helix	69-71	3
β-strand	73	1	1
α-helix	76-81	6
α-helix	83-86	4
β-strand	92-100	9	1
β-strand	105-115	11	1
β-strand	118-128	11	1
β-strand	141	1	2
β-strand	148-155	8	1
β-strand	160-170	11	1
β-strand	171	1	2
β-strand	176-187	12	1
α-helix	196-197	2
β-strand	199-208	10	1
β-strand	217-227	11	1
β-strand	233-238	6	3
β-strand	244-249	6	3
β-strand	254	1	4
α-helix	255-266	12
α-helix	270-272	3
β-strand	274-277	4	3
β-strand	280-281	2	3
α-helix	282	1
β-strand	287	1	4
α-helix	289-291	3
β-strand	298-302	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
yeast enhanced green fluorescent protein,Ubiquitin	A	protein	307	Aequorea victoria, Mus musculus	P42212 (AlphaFold model), P62984 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3AI5_1 yeast enhanced green fluorescent protein,Ubiquitin (chains A)
GSHMSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPW
PTLVTTFXVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTL
VNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLA
DHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITGSMQIFVKT
LTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTL
HLVLRLR

Primary citation

Crystallization of small proteins assisted by green fluorescent protein. Suzuki, N., Hiraki, M., Yamada, Y. et al. Acta Crystallogr D Biol Crystallogr (2010) 66:1059-1066. DOI 10.1107/S0907444910032944 · PubMed

Other PDB entries of the same protein (UniProt P42212 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6L27 0.77 Å, X-ray crystal structure of the mutant green fluorescent protein
6JGJ 0.78 Å, Crystal structure of the F99S/M153T/V163A/E222Q variant of GFP at 0.78 A
6KL0 0.8 Å, Crystal structure of the S65T/F99S/M153T/V163A variant of perdeuterated GFP at pD 7.0
6JGI 0.85 Å, Crystal structure of the S65T/F99S/M153T/V163A variant of GFP at 0.85 A
6KL1 0.85 Å, Crystal structure of the S65T/F99S/M153T/V163A variant of non-deuterated GFP at pD 8.5
2WUR 0.9 Å, Atomic resolution structure of GFP measured on a rotating anode
6KKZ 0.9 Å, Crystal structure of the S65T/F99S/M153T/V163A variant of perdeuterated GFP at pD 8.5
6JGH 0.94 Å, Crystal structure of the F99S/M153T/V163A/T203I variant of GFP at 0.94 A
4AS8 1.02 Å, X-ray structure of the cyan fluorescent protein Cerulean cryoprotected with ethylene…
5OXC 1.02 Å, Structure of Cerulean Fluorescent Protein at 1.02 Angstrom resolution
7PCA 1.05 Å, Functional and structural characterization of redox sensitive superfolder green…
4GF6 1.1 Å, crystal structure of GFP with cuprum bound at the Incorporated metal Chelating Amino…

Browse structure collections

About this viewer

MolViewer shows 3AI5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.