3AT0: Clumping factor B

Structural and biochemical characterization of ClfB:ligand interactions. Determined by X-ray diffraction at 2.5 Å resolution. Released 4 May 2011.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Staphylococcus aureus, Homo sapiens
Chains: 2
Atoms: 2,751
Mol. weight: 38.97 kDa
Released: 4 May 2011

Explore 3AT0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3AT0 contains 6 α-helices and 33 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	214	1	1
α-helix	216-218	3
β-strand	219-226	8	1
β-strand	230-231	2	2
β-strand	235	1	3
β-strand	239-247	9	1
β-strand	256-260	5	1
β-strand	265-266	2	4
β-strand	269	1	5
β-strand	271	1	6
β-strand	279-287	9	1
β-strand	292-299	8	1
β-strand	304-309	6	1
α-helix	311-315	5
β-strand	319-327	9	1
β-strand	328-329	2	4
β-strand	338-341	4	2
β-strand	344-346	3	1
β-strand	350-351	2	1
β-strand	354-357	4	2
α-helix	359-361	3
β-strand	365	1	7
β-strand	373	1	7
β-strand	374-381	8	6
β-strand	389-396	8	6
β-strand	403-411	9	3
α-helix	417-419	3
β-strand	422-423	2	6
β-strand	430-436	7	6
α-helix	439-441	3
β-strand	455-457	3	6
α-helix	459-462	4
β-strand	466-470	5	3
β-strand	473-481	9	3
β-strand	485-493	9	6
β-strand	501-509	9	3
β-strand	518-527	10	3

Chain B: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	337-342	6	3
β-strand	343	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Clumping factor B	A	protein	338	Staphylococcus aureus	Q7A382 (AlphaFold model)
C-terminal alpha chain peptide	B	protein	16	Homo sapiens	P02671 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3AT0_1 Clumping factor B (chains A)
HHHHHHGSGTNVNDKVTASNFKLEKTTFDPNQSGNTFMAANFTVTDKVKSGDYFTAKLPD
SLTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNNKENINGQF
SLPLFTDRAKAPKSGTYDANINIADEMFNNKITYNYSSPIAGIDKPNGANISSQIIGVDT
ASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLS
ESYYADPNDSNLKEVTDQFKNRIYYEHPNVASIKFGDITKTYVVLVEGHYDNTGKNLKTQ
VIQENVDPVTNRDYSIFGWNNENVVRYGGGSADGDSAV

Sequence of entity 2 (B), FASTA

>3AT0_2 C-terminal alpha chain peptide (chains B)
GSWNSGSSGTGSTGNQ

Primary citation

Structural and biochemical characterization of ClfB:ligand interactions. Ganesh, V.K., Barbu, E.M., Deivanayagam, C.C.S. et al. To be published.

Other PDB entries of the same protein (UniProt Q7A382 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AU0 2.45 Å, Structural and biochemical characterization of ClfB:ligand interactions
3ASW 2.6 Å, Structural and biochemical characterization of ClfB:ligand interactions

Browse structure collections

About this viewer

MolViewer shows 3AT0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.