Crystal structure of a truncated human Tudor-SN. Determined by X-ray diffraction at 1.9 Å resolution. Released 26 Aug 2008.
Explore 3BDL in 3D Show helices and sheets RCSB PDB PDBe
3BDL contains 25 α-helices and 32 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 317-326 | 10 | 1 |
| β-strand | 330-334 | 5 | 1 |
| β-strand | 340-345 | 6 | 1 |
| β-strand | 348-349 | 2 | 2 |
| α-helix | 359-361 | 3 | |
| α-helix | 367-370 | 4 | |
| α-helix | 374-385 | 12 | |
| β-strand | 389-398 | 10 | 1 |
| β-strand | 413-420 | 8 | 1 |
| β-strand | 423-424 | 2 | 1 |
| α-helix | 425-431 | 7 | |
| β-strand | 436-437 | 2 | 2 |
| α-helix | 438-439 | 2 | |
| α-helix | 451-463 | 13 | |
| α-helix | 467-469 | 3 | |
| α-helix | 473-476 | 4 | |
| β-strand | 480-481 | 2 | 3 |
| α-helix | 486-498 | 13 | |
| β-strand | 501-509 | 9 | 3 |
| β-strand | 514-519 | 6 | 3 |
| β-strand | 524-530 | 7 | 3 |
| β-strand | 533-534 | 2 | 4 |
| β-strand | 540-542 | 3 | 5 |
| β-strand | 545-547 | 3 | 5 |
| α-helix | 548-550 | 3 | |
| α-helix | 553-564 | 12 | |
| β-strand | 568-576 | 9 | 3 |
| β-strand | 582-588 | 7 | 3 |
| β-strand | 591-592 | 2 | 3 |
| α-helix | 593-599 | 7 | |
| β-strand | 604-605 | 2 | 4 |
| α-helix | 607-609 | 3 | |
| α-helix | 615-628 | 14 | |
| α-helix | 631-633 | 3 | |
| β-strand | 658-665 | 8 | 6 |
| β-strand | 670-675 | 6 | 6 |
| α-helix | 676-678 | 3 | |
| α-helix | 679-695 | 17 | |
| β-strand | 710-714 | 5 | 7 |
| β-strand | 720-730 | 11 | 7 |
| β-strand | 733-738 | 6 | 7 |
| β-strand | 744-747 | 4 | 7 |
| α-helix | 749-751 | 3 | |
| β-strand | 752-753 | 2 | 7 |
| α-helix | 757-759 | 3 | |
| β-strand | 769-773 | 5 | 6 |
| β-strand | 776-777 | 2 | 8 |
| α-helix | 778-779 | 2 | |
| α-helix | 782-796 | 15 | |
| β-strand | 799-807 | 9 | 6 |
| α-helix | 813 | 1 | |
| β-strand | 814-819 | 6 | 6 |
| β-strand | 825 | 1 | 6 |
| α-helix | 826-832 | 7 | |
| β-strand | 837-838 | 2 | 8 |
| α-helix | 844-846 | 3 | |
| α-helix | 847-858 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Staphylococcal nuclease domain-containing protein 1 | A | protein | 570 | Homo sapiens | Q7KZF4 (AlphaFold model) |
>3BDL_1 Staphylococcal nuclease domain-containing protein 1 (chains A) MGSSHHHHHHSSGLVPRGSHMDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPRL EGENTQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATETVPAFSER TCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKE VPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGI ECPRGARNLPGLVQEGEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHIDGANL SVLLVEHALSKVHFTAERSSYYKSLLSAEEAAKQKKEKVWAHYEEQPVEEVMPVLEEKER SASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIA KFVDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTLSPAFSTRVLPAQATEYAF AFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPHVTLQFADSKGDVGLGLVKE GLVMVEVRKEKQFQKVITEYLNAQESAKSA
| ID | Name | Formula | Copies |
|---|---|---|---|
| CIT | Citric acid | C6 H8 O7 | 4 |
Structural and functional insights into human Tudor-SN, a key component linking RNA interference and editing. Li, C.L., Yang, W.Z., Chen, Y.P. et al. Nucleic Acids Res (2008) 36:3579-3589. DOI 10.1093/nar/gkn236 · PubMed
Other PDB entries of the same protein (UniProt Q7KZF4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3BDL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.