3BDW: Human CD94/NKG2A

Human CD94/NKG2A. Determined by X-ray diffraction at 2.5 Å resolution. Released 1 Jan 2008.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,922
Mol. weight: 56.37 kDa
Released: 1 Jan 2008

Explore 3BDW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3BDW contains 14 α-helices and 48 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	66-68	3	1
β-strand	71-75	5	1
β-strand	80	1	2
α-helix	82-91	10
β-strand	95-96	2	1
α-helix	102-108	7
β-strand	115-116	2	3
β-strand	119-122	4	4
β-strand	127-130	4	4
α-helix	134	1
β-strand	135	1	4
α-helix	136-137	2
α-helix	142-146	5
β-strand	152-156	5	3
β-strand	160-164	5	3
β-strand	170	1	2
β-strand	171-172	2	3
β-strand	173-176	4	1

Chains B and D: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	124-125	2	1
β-strand	130-138	9	1
α-helix	140-149	10
β-strand	153-154	2	1
α-helix	160-169	10
β-strand	172-178	7	5
β-strand	187-188	2	5
β-strand	193	1	5
β-strand	208-212	5	5
β-strand	216-219	4	5
β-strand	225-226	2	1
β-strand	227	1	5
β-strand	228-230	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Natural killer cells antigen CD94	A, C	protein	123	Homo sapiens	Q13241 (AlphaFold model)
NKG2-A/NKG2-B type II integral membrane protein	B, D	protein	120	Homo sapiens	P26715 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>3BDW_1 Natural killer cells antigen CD94 (chains A, C)
DCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYW
IGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQ
QLI

Sequence of entity 2 (B, D), FASTA

>3BDW_2 NKG2-A/NKG2-B type II integral membrane protein (chains B, D)
ARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPS
SWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHK

Primary citation

The Heterodimeric Assembly of the CD94-NKG2 Receptor Family and Implications for Human Leukocyte Antigen-E Recognition. Sullivan, L.C., Clements, C.S., Beddoe, T. et al. Immunity (2007) 27:900-911. DOI 10.1016/j.immuni.2007.10.013 · PubMed

Other PDB entries of the same protein (UniProt Q13241 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1B6E 2.6 Å, Human CD94
3CDG 3.4 Å, Human CD94/NKG2A in complex with HLA-E
3CII 4.41 Å, Structure of NKG2A/CD94 bound to HLA-E

Browse structure collections

About this viewer

MolViewer shows 3BDW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.