3BIM: BCL6 BTB domain dimer

Crystal structure of the BCL6 BTB domain dimer in complex with the BCOR BBD corepressor peptide. Determined by X-ray diffraction at 2.6 Å resolution. Released 8 Jan 2008.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 16
Atoms: 9,091
Mol. weight: 131.9 kDa
Released: 8 Jan 2008

Explore 3BIM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3BIM contains 55 α-helices and 50 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	1
α-helix	14-28	15
β-strand	34-38	5	2
β-strand	41-45	5	2
α-helix	47-53	7
α-helix	55-62	8
β-strand	71-73	3	2
α-helix	80-92	13
β-strand	94-96	3	3
α-helix	102-112	11
α-helix	115-122	8

Chain B: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	3
α-helix	14-27	14
β-strand	34-38	5	4
β-strand	41-45	5	4
α-helix	47-53	7
α-helix	55-61	7
β-strand	69	1	5
β-strand	71-73	3	4
α-helix	80-92	13
β-strand	94-97	4	1
α-helix	102-111	10
α-helix	115-122	8

Chain C: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	6
α-helix	14-27	14
β-strand	34-38	5	7
β-strand	41-45	5	7
α-helix	47-53	7
α-helix	55-61	7
β-strand	71-73	3	7
α-helix	80-92	13
β-strand	94-95	2	8
α-helix	102-111	10
α-helix	115-122	8

Chain D: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	8
α-helix	14-27	14
β-strand	34-38	5	9
β-strand	41-45	5	9
α-helix	47-53	7
α-helix	55-62	8
β-strand	69	1	5
β-strand	71-73	3	9
α-helix	80-92	13
β-strand	94-97	4	6
α-helix	102-111	10
α-helix	115-123	9

Chain E: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	10
α-helix	14-27	14
β-strand	34-38	5	11
β-strand	41-45	5	11
α-helix	47-53	7
α-helix	55-62	8
β-strand	71-73	3	11
α-helix	80-90	11
β-strand	94-95	2	12
α-helix	102-111	10
α-helix	115-122	8

Chain F: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	9-11	3	12
α-helix	14-27	14
β-strand	34-38	5	13
β-strand	41-45	5	13
α-helix	47-53	7
α-helix	55-62	8
β-strand	71-73	3	13
α-helix	80-92	13
β-strand	94-97	4	10
α-helix	102-112	11
α-helix	115-122	8

Chain G: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	14
α-helix	14-27	14
β-strand	34-38	5	15
β-strand	41-45	5	15
α-helix	47-53	7
α-helix	55-62	8
β-strand	71-73	3	15
α-helix	80-92	13
β-strand	94-97	4	16
α-helix	102-111	10
α-helix	115-124	10

Chain H: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	16
α-helix	14-27	14
β-strand	34-38	5	17
β-strand	41-45	5	17
α-helix	47-53	7
α-helix	55-61	7
β-strand	71-74	4	17
α-helix	80-92	13
β-strand	94-95	2	14
α-helix	102-111	10
α-helix	115-123	9

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
B-cell lymphoma 6 protein	A, B, C, D, E, F, G, H	protein	127	Homo sapiens	P41182 (AlphaFold model)
BCL-6 corepressor	I, J, K, L, M, N, O, P	protein	19	Homo sapiens	Q6W2J9 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>3BIM_1 B-cell lymphoma 6 protein (chains A, B, C, D, E, F, G, H)
GSADSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFT
DQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCR
KFIKASE

Sequence of entity 2 (I, J, K, L, M, N, O, P), FASTA

>3BIM_2 BCL-6 corepressor (chains I, J, K, L, M, N, O, P)
GSRSEIISTAPSSWVVPGP

Primary citation

Structure of a BCOR corepressor peptide in complex with the BCL6 BTB domain dimer. Ghetu, A.F., Corcoran, C.M., Cerchietti, L. et al. Mol Cell (2008) 29:384-391. DOI 10.1016/j.molcel.2007.12.026 · PubMed

Other PDB entries of the same protein (UniProt P41182 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LWE 1.17 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-7629
7RV1 1.17 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8826
7OKL 1.2 Å, Crystal structure of human BCL6 BTB domain in complex with compound 13e
7LWF 1.22 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-9320
7RV4 1.25 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-9153
7RV8 1.25 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-10268
7RUY 1.27 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8388
7RV2 1.29 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8828
1R29 1.3 Å, Crystal Structure of the B-Cell Lymphoma 6 (BCL6) BTB Domain to 1.3 Angstrom
7LWG 1.3 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-12694
7RUW 1.3 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-7859
7RUX 1.3 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8311

Browse structure collections

About this viewer

MolViewer shows 3BIM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.