3BPJ: PDB entry 3BPJ

Name: PDB 3BPJ: Crystal structure of human translation initiation factor 3, subunit 1 alpha
Published: 2008-01-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: translation

Crystal structure of human translation initiation factor 3, subunit 1 alpha. Determined by X-ray diffraction at 1.85 Å resolution. Released 15 Jan 2008.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,183
Mol. weight: 36.73 kDa
Released: 15 Jan 2008

Explore 3BPJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3BPJ contains 15 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	153-167	15
α-helix	168-170	3
α-helix	176-188	13
α-helix	193-212	20

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	153-168	16
α-helix	176-188	13
α-helix	193-210	18

Chain C: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	153-167	15
α-helix	168-170	3
α-helix	176-188	13
α-helix	193-215	23

Chain D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	153-167	15
α-helix	168-170	3
α-helix	176-188	13
α-helix	193-211	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation initiation factor 3 subunit J	A, B, C, D	protein	80	Homo sapiens	O75822 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3BPJ_1 Eukaryotic translation initiation factor 3 subunit J (chains A, B, C, D)
AVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKIT
NSLTVLCSEKQKQEKQSKAK

Primary citation

Crystal structure of human translation initiation factor 3, subunit 1 alpha. Nedyalkova, L., Hong, B., Tempel, W. et al. To be published.

Other PDB entries of the same protein (UniProt O75822 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YBW 3.1 Å, Structure of a human 48S translational initiation complex - 40S body
6ZMW 3.7 Å, Structure of a human 48S translational initiation complex
6ZVJ 3.8 Å, Structure of a human ABCE1-bound 43S pre-initiation complex - State II
2KRB Solution structure of EIF3B-RRM bound to EIF3J peptide

Browse structure collections

About this viewer

MolViewer shows 3BPJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.