3BUM: C-Cbl-TKB domain

Crystal structure of c-Cbl-TKB domain complexed with its binding motif in Sprouty2. Determined by X-ray diffraction at 2.0 Å resolution. Released 26 Feb 2008.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,860
Mol. weight: 39.77 kDa
Released: 26 Feb 2008

Explore 3BUM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3BUM contains 20 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	57-59	3

Chain B: 19 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	53-70	18
α-helix	73-75	3
α-helix	84-100	17
α-helix	106-111	6
α-helix	113-136	24
α-helix	137-141	5
α-helix	146-168	23
α-helix	170-172	3
α-helix	176-178	3
α-helix	184-194	11
β-strand	199-201	3	1
α-helix	202-212	11
α-helix	218-228	11
β-strand	235-237	3	1
α-helix	238-247	10
α-helix	251-253	3
α-helix	254-258	5
α-helix	259-263	5
β-strand	268	1	2
α-helix	274-281	8
α-helix	282-284	3
β-strand	290-295	6	2
β-strand	303-308	6	2
β-strand	314-317	4	2
α-helix	324-333	10
β-strand	339-340	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein sprouty homolog 2	A	protein	13	Homo sapiens	O43597 (AlphaFold model)
E3 ubiquitin-protein ligase CBL	B	protein	329	Homo sapiens	P22681 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3BUM_1 Protein sprouty homolog 2 (chains A)
IRNTNEYTEGPTV

Sequence of entity 2 (B), FASTA

>3BUM_2 E3 ubiquitin-protein ligase CBL (chains B)
GSLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPP
YILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYE
ENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPW
KSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLA
VTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNK
PLFQALIDGFREGFYLFPDGRNQNPDLTG

Primary citation

Structural basis for a novel intrapeptidyl H-bond and reverse binding of c-Cbl-TKB domain substrates. Ng, C., Jackson, R.A., Buschdorf, J.P. et al. EMBO J (2008) 27:804-816. DOI 10.1038/emboj.2008.18 · PubMed

Other PDB entries of the same protein (UniProt O43597 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5HKY 1.8 Å, Crystal structure of c-Cbl TKBD domain in complex with SPRY2 peptide (36-60, pY55)…
5HKZ 1.8 Å, Crystal Structure of c-Cbl TKBD in complex with SPRY2 peptide (36-60, pY55) Refined to…
3OB1 2.2 Å, Crystal structure of c-Cbl TKB domain in complex with double phosphorylated Spry2 peptide
5HL0 2.2 Å, Crystal Structure of c-Cbl TKBD in complex with SPRY2 peptide (54-60, pY55) Refined to…

Browse structure collections

About this viewer

MolViewer shows 3BUM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.