3BUN: C-Cbl-TKB domain

Crystal structure of c-Cbl-TKB domain complexed with its binding motif in Sprouty4. Determined by X-ray diffraction at 2.0 Å resolution. Released 26 Feb 2008.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,906
Mol. weight: 39.78 kDa
Released: 26 Feb 2008

Explore 3BUN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3BUN contains 18 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	54	1	1

Chain B: 18 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	53-70	18
α-helix	73-75	3
α-helix	84-101	18
α-helix	106-111	6
α-helix	113-136	24
α-helix	137-141	5
α-helix	146-168	23
α-helix	170-172	3
α-helix	176-178	3
α-helix	184-194	11
β-strand	199-201	3	2
α-helix	202-212	11
α-helix	218-228	11
β-strand	235-237	3	2
α-helix	238-247	10
α-helix	251-253	3
α-helix	254-258	5
α-helix	259-263	5
β-strand	268	1	1
α-helix	274-282	9
β-strand	290-295	6	1
β-strand	303-308	6	1
β-strand	314-317	4	1
α-helix	324-333	10
β-strand	339-340	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
13-meric peptide from Protein sprouty homolog 4	A	protein	13	Homo sapiens	Q9C004 (AlphaFold model)
E3 ubiquitin-protein ligase CBL	B	protein	329	Homo sapiens	P22681 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3BUN_1 13-meric peptide from Protein sprouty homolog 4 (chains A)
SHVENDYIDNPSL

Sequence of entity 2 (B), FASTA

>3BUN_2 E3 ubiquitin-protein ligase CBL (chains B)
GSLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPP
YILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYE
ENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPW
KSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLA
VTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNK
PLFQALIDGFREGFYLFPDGRNQNPDLTG

Primary citation

Structural basis for a novel intrapeptidyl H-bond and reverse binding of c-Cbl-TKB domain substrates. Ng, C., Jackson, R.A., Buschdorf, J.P. et al. EMBO J (2008) 27:804-816. DOI 10.1038/emboj.2008.18 · PubMed

Browse structure collections

About this viewer

MolViewer shows 3BUN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.