3BUX: C-Cbl-TKB domain

Crystal structure of c-Cbl-TKB domain complexed with its binding motif in c-Met. Determined by X-ray diffraction at 1.35 Å resolution. Released 26 Feb 2008.

Method: X-ray diffraction
Resolution: 1.35 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,820
Mol. weight: 79.58 kDa
Released: 26 Feb 2008

Explore 3BUX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3BUX contains 40 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains B and D: 20 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	48-51	4
α-helix	53-70	18
α-helix	73-75	3
α-helix	84-101	18
α-helix	106-111	6
α-helix	113-136	24
α-helix	137-141	5
α-helix	146-168	23
α-helix	170-172	3
α-helix	176-178	3
α-helix	184-194	11
β-strand	199-201	3	1
α-helix	202-212	11
α-helix	218-228	11
β-strand	235-237	3	1
α-helix	238-247	10
α-helix	251-253	3
α-helix	254-258	5
α-helix	259-263	5
β-strand	268	1	2
α-helix	274-281	8
α-helix	282-284	3
β-strand	290-295	6	2
β-strand	303-308	6	2
β-strand	314-317	4	2
α-helix	324-334	11
β-strand	339-340	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
13-meric peptide from Hepatocyte growth factor receptor	A, C	protein	13		P08581 (AlphaFold model)
E3 ubiquitin-protein ligase CBL	B, D	protein	329	Homo sapiens	P22681 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>3BUX_1 13-meric peptide from Hepatocyte growth factor receptor (chains A, C)
SNESVDYRATFPE

Sequence of entity 2 (B, D), FASTA

>3BUX_2 E3 ubiquitin-protein ligase CBL (chains B, D)
GSLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPP
YILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYE
ENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPW
KSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLA
VTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNK
PLFQALIDGFREGFYLFPDGRNQNPDLTG

Primary citation

Structural basis for a novel intrapeptidyl H-bond and reverse binding of c-Cbl-TKB domain substrates. Ng, C., Jackson, R.A., Buschdorf, J.P. et al. EMBO J (2008) 27:804-816. DOI 10.1038/emboj.2008.18 · PubMed

Other PDB entries of the same protein (UniProt P08581 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9T6K 1.13 Å, Crystal structure of wild-type c-MET bound by glumetinib.
9T0D 1.2 Å, Crystal structure of wild-type c-MET bound by glesatinib
4R1V 1.2 Å, Identification and optimization of pyridazinones as potent and selective c-Met kinase…
9SXJ 1.31 Å, Crystal structure of wild-type c-MET bound by capmatinib.
3F66 1.4 Å, Human c-Met Kinase in complex with quinoxaline inhibitor
3ZCL 1.4 Å, X-ray Structure of c-Met kinase in complex with inhibitor…
9T08 1.46 Å, Crystal structure of wild-type c-MET bound by sitravatinib.
3DKC 1.52 Å, Structure of MET receptor tyrosine kinase in complex with ATP
9T0B 1.54 Å, Crystal structure of D1228V c-MET bound by sitravatinib.
9C1R 1.59 Å, Crystal structure of mutant cMET D1228N kinase domain in complex with inhibitor compound…
3Q6U 1.6 Å, Structure of the apo MET receptor kinase in the dually-phosphorylated, activated state
9T3Q 1.63 Å, Crystal structure of D1228V c-MET bound by cabozantinib.

Browse structure collections

About this viewer

MolViewer shows 3BUX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.