3C0N: Proaerolysin mutant Y221G

Crystal structure of the proaerolysin mutant Y221G at 2.2 A. Determined by X-ray diffraction at 2.2 Å resolution. Released 12 Feb 2008.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Aeromonas hydrophila
Chains: 2
Atoms: 7,456
Mol. weight: 103.75 kDa
Released: 12 Feb 2008

Explore 3C0N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3C0N contains 41 α-helices and 58 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	10-12	3	1
β-strand	23-25	3	1
α-helix	26-27	2
α-helix	28-33	6
α-helix	35-39	5
β-strand	47-50	4	1
β-strand	54-57	4	1
α-helix	59-61	3
β-strand	65-67	3	1
β-strand	73-77	5	1
α-helix	84-86	3
α-helix	88-90	3
β-strand	91-93	3	2
α-helix	98-106	9
α-helix	109-113	5
α-helix	114-123	10
β-strand	125	1	3
β-strand	140-144	5	2
β-strand	149-153	5	2
β-strand	169-186	18	2
β-strand	191-206	16	2
β-strand	212	1	4
β-strand	215-229	15	2
α-helix	235-237	3
β-strand	240	1	2
β-strand	245-246	2	5
α-helix	247-249	3
β-strand	258-259	2	5
α-helix	265-267	3
β-strand	270-277	8	2
β-strand	280-281	2	2
β-strand	285	1	4
β-strand	289-321	33	2
β-strand	322	1	3
α-helix	323	1
β-strand	329	1	6
β-strand	338-345	8	2
α-helix	355-360	6
α-helix	365-367	3
β-strand	371	1	6
α-helix	373-380	8
α-helix	382-392	11
α-helix	394-395	2
β-strand	396-411	16	2
β-strand	415-416	2	2
β-strand	420-421	2	2
β-strand	442-444	3	2
α-helix	449-455	7
β-strand	458-466	9	2

Chain B: 21 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	10-12	3	7
β-strand	23-25	3	7
α-helix	26-27	2
α-helix	28-33	6
α-helix	35-39	5
β-strand	47-50	4	7
β-strand	54-57	4	7
α-helix	59-61	3
β-strand	65-67	3	7
β-strand	73-77	5	7
α-helix	80-82	3
α-helix	84-86	3
α-helix	88-90	3
β-strand	91-93	3	8
α-helix	98-106	9
α-helix	109-113	5
α-helix	114-122	9
β-strand	125	1	9
β-strand	140-145	6	8
β-strand	148-153	6	8
β-strand	169-186	18	8
β-strand	191-206	16	8
β-strand	212	1	10
β-strand	215-229	15	8
α-helix	235-237	3
β-strand	240	1	8
β-strand	245-246	2	11
α-helix	247-249	3
β-strand	258-259	2	11
α-helix	260	1
α-helix	265-267	3
β-strand	270-281	12	8
β-strand	285	1	10
β-strand	289-321	33	8
β-strand	322	1	9
α-helix	323	1
β-strand	329	1	12
β-strand	338-345	8	8
α-helix	355-360	6
α-helix	365-367	3
β-strand	371	1	12
α-helix	373-380	8
α-helix	382-392	11
β-strand	396-416	21	8
β-strand	420-421	2	8
β-strand	442-444	3	8
α-helix	449-455	7
β-strand	458-466	9	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Aerolysin	A, B	protein	470	Aeromonas hydrophila	P09167 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3C0N_1 Aerolysin (chains A, B)
AEPVYPDQLRLFSLGQGVCGDKYRPVNREEAQSVKSNIVGMMGQWQISGLANGWVIMGPG
YNGEIKPGTASNTWCYPTNPVTGEIPTLSALDIPDGDEVDVQWRLVHDSANFIKPTSYLA
HYLGYAWVGGNHSQYVGEDMDVTRDGDGWVIRGNNDGGCDGYRCGDKTAIKVSNFAYNLD
PDSFKHGDVTQSDRQLVKTVVGWAVNDSDTPQSGYDVTLRGDTATNWSKTNTYGLSEKVT
TKNKFKWPLVGETELSIEIAANQSWASQNGGSTTTSLSQSVRPTVPARSKIPVKIELYKA
DISYPYEFKADVSYDLTLSGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSIRYQWD
KRYIPGEVKWWDWNWTIQQNGLSTMQNNLARVLRPVRAGITGDFSAESQFAGNIEIGAPV
PLAADSKVRRARSVDGAGQGLRLEIPLDAQELSGLGFNNVSLSVTPAANQ

Primary citation

Molecular assembly of the aerolysin pore reveals a swirling membrane-insertion mechanism. Degiacomi, M.T., Iacovache, I., Pernot, L. et al. Nat Chem Biol (2013) 9:623-629. DOI 10.1038/nchembio.1312 · PubMed

Other PDB entries of the same protein (UniProt P09167 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3G4N 2.1 Å, Crystal structure of the activated aerolysin mutant H132D
9FNQ 2.1 Å, Aerolysin double mutant K238A/K244A in styrene-maleic acid lipid particles
9FM6 2.2 Å, Aerolysin Wildtype in styrene-maleic acid lipid particles
9FML 2.2 Å, Aerolysin heptamer in membrane inserted form reconstituted in amphipoles.
9FMX 2.2 Å, Aerolysin Y221G - prepore
9FNP 2.2 Å, Aerolysin mutant K238A in styrene-maleic acid lipid particles
3G4O 2.3 Å, Crystal structure of the activated aerolysin mutant H132N
9GXJ 2.3 Å, Aerolysin E254A/E258A in styrene-maleic acid lipid particles
9IGN 2.3 Å, Aerolysin E254A/E258A in styrene-maleic acid lipid particles
1Z52 2.38 Å, Proaerolysin Mutant W373L
3C0O 2.5 Å, Crystal structure of the proaerolysin mutant Y221G complexed with mannose-6-phosphate
1PRE 2.8 Å, Proaerolysin

Browse structure collections

About this viewer

MolViewer shows 3C0N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.