Structure of human parathyroid hormone in complex with the extracellular domain of its G-protein-coupled receptor (PTH1R). Determined by X-ray diffraction at 1.95 Å resolution. Released 8 Apr 2008.
Explore 3C4M in 3D Show helices and sheets RCSB PDB PDBe
3C4M contains 65 α-helices and 69 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | -337--334 | 4 | 1 |
| α-helix | -327--313 | 15 | |
| β-strand | -309--306 | 4 | 1 |
| α-helix | -301--294 | 8 | |
| α-helix | -293--291 | 3 | |
| β-strand | -285--281 | 5 | 1 |
| α-helix | -280--278 | 3 | |
| α-helix | -277--272 | 6 | |
| β-strand | -268 | 1 | 2 |
| α-helix | -267--265 | 3 | |
| α-helix | -261--257 | 5 | |
| β-strand | -255 | 1 | 3 |
| α-helix | -253--248 | 6 | |
| β-strand | -246--245 | 2 | 4 |
| β-strand | -242--241 | 2 | 4 |
| β-strand | -238--233 | 6 | 1 |
| β-strand | -230--226 | 5 | 5 |
| β-strand | -216 | 1 | 6 |
| α-helix | -212--204 | 9 | |
| β-strand | -199--197 | 3 | 5 |
| α-helix | -190--181 | 10 | |
| β-strand | -177--172 | 6 | 7 |
| β-strand | -169--162 | 8 | 7 |
| α-helix | -158--144 | 15 | |
| α-helix | -134--126 | 9 | |
| β-strand | -122--117 | 6 | 5 |
| α-helix | -115--113 | 3 | |
| α-helix | -112--106 | 7 | |
| β-strand | -102--99 | 4 | 5 |
| α-helix | -98--96 | 3 | |
| β-strand | -95 | 1 | 6 |
| β-strand | -94 | 1 | 8 |
| β-strand | -91 | 1 | 8 |
| α-helix | -90--89 | 2 | |
| α-helix | -87 | 1 | |
| β-strand | -86--85 | 2 | 9 |
| β-strand | -84--78 | 7 | 1 |
| β-strand | -77 | 1 | 2 |
| α-helix | -71--65 | 7 | |
| α-helix | -64--60 | 5 | |
| α-helix | -57--48 | 10 | |
| β-strand | -43--42 | 2 | 1 |
| β-strand | -40 | 1 | 3 |
| α-helix | -39--33 | 7 | |
| α-helix | -29--18 | 12 | |
| β-strand | -16--15 | 2 | 9 |
| α-helix | -14--13 | 2 | |
| α-helix | -8-7 | 16 | |
| α-helix | 13-28 | 16 | |
| α-helix | 34-53 | 20 | |
| β-strand | 108 | 1 | 10 |
| β-strand | 112 | 1 | 11 |
| β-strand | 117 | 1 | 11 |
| β-strand | 121 | 1 | 10 |
| β-strand | 126-130 | 5 | 12 |
| α-helix | 131-132 | 2 | |
| β-strand | 143-147 | 5 | 12 |
| β-strand | 148 | 1 | 13 |
| β-strand | 154 | 1 | 13 |
| α-helix | 155 | 1 | |
| β-strand | 156 | 1 | 14 |
| α-helix | 157 | 1 | |
| α-helix | 162 | 1 | |
| β-strand | 163 | 1 | 14 |
| α-helix | 164 | 1 | |
| β-strand | 166 | 1 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | -337--334 | 4 | 15 |
| α-helix | -327--313 | 15 | |
| β-strand | -309--306 | 4 | 15 |
| α-helix | -301--294 | 8 | |
| α-helix | -293--291 | 3 | |
| β-strand | -285--281 | 5 | 15 |
| α-helix | -280--278 | 3 | |
| α-helix | -277--272 | 6 | |
| β-strand | -268 | 1 | 16 |
| α-helix | -267--265 | 3 | |
| α-helix | -261--258 | 4 | |
| β-strand | -255 | 1 | 17 |
| α-helix | -253--248 | 6 | |
| β-strand | -246--245 | 2 | 18 |
| β-strand | -242--241 | 2 | 18 |
| β-strand | -238--233 | 6 | 15 |
| β-strand | -230--226 | 5 | 19 |
| β-strand | -216 | 1 | 20 |
| α-helix | -215--213 | 3 | |
| α-helix | -212--204 | 9 | |
| β-strand | -199--197 | 3 | 19 |
| α-helix | -190--181 | 10 | |
| β-strand | -177--172 | 6 | 21 |
| β-strand | -169--162 | 8 | 21 |
| α-helix | -158--144 | 15 | |
| α-helix | -134--126 | 9 | |
| β-strand | -122--117 | 6 | 19 |
| α-helix | -115--113 | 3 | |
| α-helix | -112--106 | 7 | |
| β-strand | -102--99 | 4 | 19 |
| α-helix | -98--96 | 3 | |
| β-strand | -95--94 | 2 | 20 |
| β-strand | -91--90 | 2 | 20 |
| α-helix | -87 | 1 | |
| β-strand | -86--85 | 2 | 22 |
| β-strand | -84--78 | 7 | 15 |
| β-strand | -77 | 1 | 16 |
| α-helix | -71--65 | 7 | |
| α-helix | -64--60 | 5 | |
| α-helix | -57--48 | 10 | |
| β-strand | -43--42 | 2 | 15 |
| β-strand | -40 | 1 | 17 |
| α-helix | -39--33 | 7 | |
| α-helix | -29--18 | 12 | |
| β-strand | -16--15 | 2 | 22 |
| α-helix | -14--13 | 2 | |
| α-helix | -8-8 | 17 | |
| α-helix | 13-28 | 16 | |
| α-helix | 34-56 | 23 | |
| α-helix | 106-107 | 2 | |
| β-strand | 108 | 1 | 23 |
| α-helix | 109-110 | 2 | |
| β-strand | 111-112 | 2 | 24 |
| β-strand | 117-118 | 2 | 24 |
| β-strand | 121 | 1 | 23 |
| α-helix | 125 | 1 | |
| β-strand | 126-130 | 5 | 25 |
| α-helix | 131-132 | 2 | |
| β-strand | 143-147 | 5 | 25 |
| β-strand | 148 | 1 | 26 |
| β-strand | 154 | 1 | 26 |
| α-helix | 155 | 1 | |
| β-strand | 156 | 1 | 27 |
| α-helix | 157 | 1 | |
| β-strand | 163 | 1 | 27 |
| β-strand | 166 | 1 | 25 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-33 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fusion protein of Maltose-binding periplasmic protein and Parathyroid hormone/parathyroid… | A, B | protein | 539 | Escherichia coli, Homo sapiens | P0AEX9 (AlphaFold model), Q03431 (AlphaFold model) |
| Parathyroid hormone | C, D | protein | 21 | P01270 (AlphaFold model) |
>3C4M_1 Fusion protein of Maltose-binding periplasmic protein and Parathyroid hormone/parathyroid hormone-related peptide receptor (chains A, B) MAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPD IIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYN KDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDI KDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTS KVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKP LGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVD EALKDAQTNAAAEFDDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSAST SGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDY IYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLHHHHHH
>3C4M_2 Parathyroid hormone (chains C, D) LNSMERVEWLRKKLQDVHNFX
Molecular recognition of parathyroid hormone by its G protein-coupled receptor. Pioszak, A.A., Xu, H.E. Proc Natl Acad Sci U S A (2008) 105:5034-5039. DOI 10.1073/pnas.0801027105 · PubMed
Other PDB entries of the same protein (UniProt P0AEX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3C4M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.