3C4M: Human parathyroid hormone

Structure of human parathyroid hormone in complex with the extracellular domain of its G-protein-coupled receptor (PTH1R). Determined by X-ray diffraction at 1.95 Å resolution. Released 8 Apr 2008.

Method: X-ray diffraction
Resolution: 1.95 Å
Organisms: Escherichia coli, Homo sapiens
Chains: 4
Atoms: 8,349
Mol. weight: 126.37 kDa
Released: 8 Apr 2008

Explore 3C4M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3C4M contains 65 α-helices and 69 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 35 β-strands

Element	Residues	Length	Sheet
β-strand	-337--334	4	1
α-helix	-327--313	15
β-strand	-309--306	4	1
α-helix	-301--294	8
α-helix	-293--291	3
β-strand	-285--281	5	1
α-helix	-280--278	3
α-helix	-277--272	6
β-strand	-268	1	2
α-helix	-267--265	3
α-helix	-261--257	5
β-strand	-255	1	3
α-helix	-253--248	6
β-strand	-246--245	2	4
β-strand	-242--241	2	4
β-strand	-238--233	6	1
β-strand	-230--226	5	5
β-strand	-216	1	6
α-helix	-212--204	9
β-strand	-199--197	3	5
α-helix	-190--181	10
β-strand	-177--172	6	7
β-strand	-169--162	8	7
α-helix	-158--144	15
α-helix	-134--126	9
β-strand	-122--117	6	5
α-helix	-115--113	3
α-helix	-112--106	7
β-strand	-102--99	4	5
α-helix	-98--96	3
β-strand	-95	1	6
β-strand	-94	1	8
β-strand	-91	1	8
α-helix	-90--89	2
α-helix	-87	1
β-strand	-86--85	2	9
β-strand	-84--78	7	1
β-strand	-77	1	2
α-helix	-71--65	7
α-helix	-64--60	5
α-helix	-57--48	10
β-strand	-43--42	2	1
β-strand	-40	1	3
α-helix	-39--33	7
α-helix	-29--18	12
β-strand	-16--15	2	9
α-helix	-14--13	2
α-helix	-8-7	16
α-helix	13-28	16
α-helix	34-53	20
β-strand	108	1	10
β-strand	112	1	11
β-strand	117	1	11
β-strand	121	1	10
β-strand	126-130	5	12
α-helix	131-132	2
β-strand	143-147	5	12
β-strand	148	1	13
β-strand	154	1	13
α-helix	155	1
β-strand	156	1	14
α-helix	157	1
α-helix	162	1
β-strand	163	1	14
α-helix	164	1
β-strand	166	1	12

Chain B: 32 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	-337--334	4	15
α-helix	-327--313	15
β-strand	-309--306	4	15
α-helix	-301--294	8
α-helix	-293--291	3
β-strand	-285--281	5	15
α-helix	-280--278	3
α-helix	-277--272	6
β-strand	-268	1	16
α-helix	-267--265	3
α-helix	-261--258	4
β-strand	-255	1	17
α-helix	-253--248	6
β-strand	-246--245	2	18
β-strand	-242--241	2	18
β-strand	-238--233	6	15
β-strand	-230--226	5	19
β-strand	-216	1	20
α-helix	-215--213	3
α-helix	-212--204	9
β-strand	-199--197	3	19
α-helix	-190--181	10
β-strand	-177--172	6	21
β-strand	-169--162	8	21
α-helix	-158--144	15
α-helix	-134--126	9
β-strand	-122--117	6	19
α-helix	-115--113	3
α-helix	-112--106	7
β-strand	-102--99	4	19
α-helix	-98--96	3
β-strand	-95--94	2	20
β-strand	-91--90	2	20
α-helix	-87	1
β-strand	-86--85	2	22
β-strand	-84--78	7	15
β-strand	-77	1	16
α-helix	-71--65	7
α-helix	-64--60	5
α-helix	-57--48	10
β-strand	-43--42	2	15
β-strand	-40	1	17
α-helix	-39--33	7
α-helix	-29--18	12
β-strand	-16--15	2	22
α-helix	-14--13	2
α-helix	-8-8	17
α-helix	13-28	16
α-helix	34-56	23
α-helix	106-107	2
β-strand	108	1	23
α-helix	109-110	2
β-strand	111-112	2	24
β-strand	117-118	2	24
β-strand	121	1	23
α-helix	125	1
β-strand	126-130	5	25
α-helix	131-132	2
β-strand	143-147	5	25
β-strand	148	1	26
β-strand	154	1	26
α-helix	155	1
β-strand	156	1	27
α-helix	157	1
β-strand	163	1	27
β-strand	166	1	25

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	16-33	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fusion protein of Maltose-binding periplasmic protein and Parathyroid hormone/parathyroid…	A, B	protein	539	Escherichia coli, Homo sapiens	P0AEX9 (AlphaFold model), Q03431 (AlphaFold model)
Parathyroid hormone	C, D	protein	21		P01270 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3C4M_1 Fusion protein of Maltose-binding periplasmic protein and Parathyroid hormone/parathyroid hormone-related peptide receptor (chains A, B)
MAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPD
IIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYN
KDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDI
KDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTS
KVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKP
LGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVD
EALKDAQTNAAAEFDDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSAST
SGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDY
IYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLHHHHHH

Sequence of entity 2 (C, D), FASTA

>3C4M_2 Parathyroid hormone (chains C, D)
LNSMERVEWLRKKLQDVHNFX

Primary citation

Molecular recognition of parathyroid hormone by its G protein-coupled receptor. Pioszak, A.A., Xu, H.E. Proc Natl Acad Sci U S A (2008) 105:5034-5039. DOI 10.1073/pnas.0801027105 · PubMed

Other PDB entries of the same protein (UniProt P0AEX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8C8F 1.15 Å, Crystal structure of the E. coli maltodextrin-binding protein
4EXK 1.28 Å, A chimera protein containing MBP fused to the C-terminal domain of the uncharacterized…
3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
7KD4 1.31 Å, Structure of the C-terminal domain of the Menangle virus phosphoprotein (residues 329…
5M13 1.37 Å, Synthetic nanobody in complex with MBP
5HZ7 1.43 Å, High-resolution crystal structure of the minor DNA-binding pilin ComP from Neisseria…
5H7Q 1.45 Å, Crystal structure of human MNDA PYD domain with MBP tag
6XDS 1.47 Å, Crystal structure of MBP-TREM2 Ig domain fusion with fragment,…
4IRL 1.47 Å, X-ray structure of the CARD domain of zebrafish GBP-NLRP1 like protein
8SVY 1.47 Å, MBP-Mcl1 in complex with ligand 10
3MP6 1.48 Å, Complex Structure of Sgf29 and dimethylated H3K4
9CLC 1.48 Å, Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Cyanotryptophan

Browse structure collections

About this viewer

MolViewer shows 3C4M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.