3C5V: PP2A-specific methylesterase apo form

PP2A-specific methylesterase apo form (PME). Determined by X-ray diffraction at 2.0 Å resolution. Released 15 Apr 2008.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,561
Mol. weight: 34.74 kDa
Released: 15 Apr 2008

Explore 3C5V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3C5V contains 15 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	46-48	3
β-strand	52-60	9	1
β-strand	63-72	10	1
β-strand	78-82	5	1
α-helix	89-92	4
α-helix	93-100	8
β-strand	103	1	2
β-strand	106-110	5	1
β-strand	119	1	1
α-helix	128-143	16
α-helix	147-149	3
β-strand	150-155	6	1
α-helix	157-167	11
β-strand	174-180	7	1
α-helix	184-200	17
β-strand	205	1	3
α-helix	208-217	10
α-helix	224-234	11
β-strand	235-237	3	3
β-strand	285-287	3	3
α-helix	291-294	4
α-helix	295-302	8
α-helix	305-311	7
β-strand	316-320	5	1
α-helix	328-335	8
β-strand	340-343	4	1
α-helix	351-354	4
α-helix	356-369	14
β-strand	375	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein phosphatase methylesterase 1	A	protein	316	Homo sapiens	Q9Y570 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3C5V_1 Protein phosphatase methylesterase 1 (chains A)
RDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGGHSALSWAVFTAA
IISRVQCRIVALDLRSHGETKVKNPEDLSAETMAKDVGNVVEAMYGDLPPPIMLIGHSMG
GAIAVHTASSNLVPSLLGLCMIDVVEGTAMDALNSMQNFLRGRPKTFKSLENAIEWSVKS
GQIRNLESARVSMVGQVKQCEGITSPEGSKKDHPYTWRIELAKTEKYWDGWFRGLSNLFL
SCPIPKLLLLAGVDRLDKDLTIGQMQGKFQMQVLPQCGHAVHEDAPDKVAEAVATFLIRH
RFAEPIGGFQCVFPGC

Primary citation

Structural mechanism of demethylation and inactivation of protein phosphatase 2A. Xing, Y., Li, Z., Chen, Y. et al. Cell (2008) 133:154-163. DOI 10.1016/j.cell.2008.02.041 · PubMed

Other PDB entries of the same protein (UniProt Q9Y570 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3C5W 2.8 Å, Complex between PP2A-specific methylesterase PME-1 and PP2A core enzyme
7SOY 3.4 Å, The structure of the PP2A-B56gamma1 holoenzyme-PME-1 complex

Browse structure collections

About this viewer

MolViewer shows 3C5V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.