3CC6: Kinase domain of protein tyrosine kinase 2 beta

Crystal structure of kinase domain of protein tyrosine kinase 2 beta (PTK2B). Determined by X-ray diffraction at 1.6 Å resolution. Released 11 Mar 2008.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,552
Mol. weight: 32.64 kDa
Ligands: MG
Released: 11 Mar 2008

Explore 3CC6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3CC6 contains 21 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	420-421	2
α-helix	422-424	3
β-strand	425-433	9	1
β-strand	438-445	8	1
β-strand	451-458	8	1
α-helix	465-481	17
β-strand	486	1	2
α-helix	487-488	2
β-strand	489-493	5	1
α-helix	498	1
β-strand	499-503	5	1
β-strand	509	1	2
α-helix	510-517	8
α-helix	523-542	20
α-helix	552-554	3
β-strand	555-559	5	2
β-strand	562-565	4	2
α-helix	567-569	3
α-helix	570-572	3
α-helix	589-591	3
α-helix	594-599	6
α-helix	604-619	16
α-helix	623-624	2
α-helix	631-633	3
α-helix	634-640	7
α-helix	644-647	4
α-helix	652-661	10
α-helix	666-668	3
α-helix	670-671	2
α-helix	672-691	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein tyrosine kinase 2 beta	A	protein	281	Homo sapiens	Q14289 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3CC6_1 Protein tyrosine kinase 2 beta (chains A)
SMGGPQYGIAREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKF
MSEAVIMKNLDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSL
QICKAMAYLESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKW
MSPESINFRRFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCP
PVLYTLMTRCWDYDPSDRPRFTELVCSLSDVYQMEKDIAME

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structure of Protein Tyrosine Kinase 2 Beta (PTK2B) Kinase domain. Busam, R.D., Lehtio, L., Karlberg, T. et al. To be published.

Other PDB entries of the same protein (UniProt Q14289 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FZS 1.75 Å, Crystal Structure of PYK2 complexed with BIRB796
4XEK 1.79 Å, Pyk2-FAT domain in complex with leupaxin LD4 motif
8XOX 1.9 Å, The Crystal Structure of FAK2 from Biortus.
3FZT 1.95 Å, Crystal structure of PYK2 complexed with PF-4618433
5TO8 1.98 Å, Selectivity switch between FAK and Pyk2: Macrocyclization of FAK inhibitors improves…
4H1M 1.99 Å, Crystal structure of PYK2 with the indole 10c
3H3C 2.0 Å, Crystal structure of PYK2 in complex with Sulfoximine-substituted…
4H1J 2.0 Å, Crystal structure of PYK2 with the pyrazole 13a
8YGX 2.0 Å, Structure of the PYK2 from Biortus.
4XEV 2.01 Å, Fusion of Pyk2-FAT domain with Leupaxin LD1 motif, complexed with Leupaxin LD4 peptide
3FZP 2.1 Å, Crystal structure of PYK2 complexed with ATPgS
5TOB 2.12 Å, Selectivity switch between FAK and Pyk2: Macrocyclization of FAK inhibitors improves…

Browse structure collections

About this viewer

MolViewer shows 3CC6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.