3CPT: MP1-p14 Scaffolding complex

MP1-p14 Scaffolding complex. Determined by X-ray diffraction at 1.9 Å resolution. Released 1 Jul 2008.

Method: X-ray diffraction
Resolution: 1.9 Å
Organisms: Homo sapiens, Mus musculus
Chains: 2
Atoms: 1,963
Mol. weight: 30.14 kDa
Released: 1 Jul 2008

Explore 3CPT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3CPT contains 8 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	4-12	9
α-helix	13-15	3
β-strand	19-25	7	1
β-strand	31-36	6	1
α-helix	42-45	4
α-helix	47-63	17
β-strand	68-74	7	1
β-strand	78-85	8	1
β-strand	88-95	8	1
α-helix	100-117	18

Chain B: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	4-12	9
β-strand	19-25	7	1
β-strand	31-36	6	1
α-helix	42-60	19
β-strand	71-76	6	1
β-strand	79-86	8	1
β-strand	89-95	7	1
α-helix	101-116	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitogen-activated protein kinase kinase 1-interacting protein 1	A	protein	143	Homo sapiens	Q9UHA4 (AlphaFold model)
Mitogen-activated protein-binding protein-interacting protein	B	protein	131	Mus musculus	Q9JHS3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3CPT_1 Mitogen-activated protein kinase kinase 1-interacting protein 1 (chains A)
MGSSHHHHHHHHENLYFQGSADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAP
EHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTG
LIVSLEKELAPLFEELRQVVEVS

Sequence of entity 2 (B), FASTA

>3CPT_2 Mitogen-activated protein-binding protein-interacting protein (chains B)
MHHHHHHLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWA
AADRNGNQAFNEDSLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQY
LEEPLTQVAAS

Primary citation

Molecular dynamics-solvated interaction energy studies of protein-protein interactions: the MP1-p14 scaffolding complex. Cui, Q., Sulea, T., Schrag, J.D. et al. J Mol Biol (2008) 379:787-802. DOI 10.1016/j.jmb.2008.04.035 · PubMed

Other PDB entries of the same protein (UniProt Q9UHA4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6B9X 1.42 Å, Crystal structure of Ragulator
1SKO 2.0 Å, MP1-p14 Complex
2ZL1 2.0 Å, MP1-p14 Scaffolding complex
5X6V 2.02 Å, Crystal structure of human heteroheptameric complex
6EHP 2.3 Å, The crystal structure of the human LAMTOR complex
5X6U 2.4 Å, Crystal structure of human heteropentameric complex
5Y39 2.65 Å, Crystal structure of Ragulator complex (p18 76-145)
6EHR 2.9 Å, The crystal structure of the human LAMTOR-RagA CTD-RagC CTD complex
5Y3A 2.9 Å, Crystal structure of Ragulator complex (p18 49-161)
7UX2 2.9 Å, cryo-EM structure of the Raptor-TFEB-Rag-Ragulator complex
5YK3 3.01 Å, human Ragulator complex
6U62 3.18 Å, Raptor-Rag-Ragulator complex

Browse structure collections

About this viewer

MolViewer shows 3CPT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.