3CQV: Reverb beta

Name: PDB 3CQV: Crystal structure of Reverb beta in complex with heme
Published: 2008-08-05
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal structure of Reverb beta in complex with heme. Determined by X-ray diffraction at 1.9 Å resolution. Released 5 Aug 2008.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,771
Mol. weight: 23.49 kDa
Ligands: HEM
Released: 5 Aug 2008

Explore 3CQV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3CQV contains 9 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	398-421	24
α-helix	424-428	5
α-helix	431-449	19
α-helix	451-453	3
β-strand	454-455	2	1
β-strand	460-462	3	1
β-strand	468-470	3	1
α-helix	471-476	6
α-helix	481-494	14
α-helix	500-512	13
α-helix	522-543	22
α-helix	549-573	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear receptor subfamily 1 group D member 2	A	protein	199	Homo sapiens	Q14995 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3CQV_1 Nuclear receptor subfamily 1 group D member 2 (chains A)
HLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKA
GTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFSEKLNALQLSD
EEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPD
LRSLNNMHSEELLAFKVHP

Ligands and cofactors

ID	Name	Formula	Copies
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	1

Primary citation

The structural basis of gas-responsive transcription by the human nuclear hormone receptor REV-ERBbeta. Pardee, K.I., Xu, X., Reinking, J. et al. PLoS Biol (2009) 7:e43-e43. DOI 10.1371/journal.pbio.1000043 · PubMed

Other PDB entries of the same protein (UniProt Q14995 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4N73 1.87 Å, Crystal structure of the ligand binding domain (LBD) of REV-ERB beta bound to Cobalt…
6WMS 2.0 Å, Crystal Structure of Human REV-ERBbeta Ligand Binding Domain Co-Bound to Heme and NCoR…
2V0V 2.4 Å, Crystal Structure of Rev-Erb beta
2V7C 2.4 Å, Crystal Structure of Rev-Erb beta
6WMQ 2.55 Å, Crystal Structure of Human REV-ERBbeta Ligand Binding Domain Co-Bound to Heme and NCoR…

Browse structure collections

About this viewer

MolViewer shows 3CQV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.