Factor inhibiting HIF-1 alpha D201G mutant in complex with ZN(II), alpha-ketoglutarate and HIF-1 alpha 19mer. Determined by X-ray diffraction at 2.1 Å resolution. Released 12 Aug 2008.
Explore 3D8C in 3D Show helices and sheets RCSB PDB PDBe
3D8C contains 21 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-17 | 2 | |
| β-strand | 18 | 1 | 1 |
| α-helix | 19 | 1 | |
| β-strand | 25 | 1 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 39-41 | 3 | 2 |
| α-helix | 42-43 | 2 | |
| β-strand | 44-45 | 2 | 3 |
| α-helix | 50-57 | 8 | |
| β-strand | 62-64 | 3 | 3 |
| α-helix | 71-75 | 5 | |
| α-helix | 78-84 | 7 | |
| β-strand | 90-95 | 6 | 3 |
| β-strand | 99 | 1 | 2 |
| α-helix | 105-107 | 3 | |
| β-strand | 118-123 | 6 | 3 |
| α-helix | 125-138 | 14 | |
| β-strand | 143-149 | 7 | 3 |
| α-helix | 156-163 | 8 | |
| α-helix | 167-176 | 10 | |
| β-strand | 182-184 | 3 | 3 |
| β-strand | 186-190 | 5 | 3 |
| β-strand | 195-199 | 5 | 2 |
| β-strand | 203-211 | 9 | 3 |
| β-strand | 214-219 | 6 | 2 |
| α-helix | 221-223 | 3 | |
| α-helix | 224-227 | 4 | |
| β-strand | 229 | 1 | 4 |
| β-strand | 230 | 1 | 5 |
| α-helix | 231 | 1 | |
| β-strand | 237 | 1 | 5 |
| β-strand | 239 | 1 | 2 |
| β-strand | 240 | 1 | 4 |
| α-helix | 253-257 | 5 | |
| β-strand | 260-265 | 6 | 2 |
| β-strand | 270-273 | 4 | 3 |
| β-strand | 278-283 | 6 | 2 |
| α-helix | 284 | 1 | |
| β-strand | 290-298 | 9 | 3 |
| α-helix | 299-303 | 5 | |
| α-helix | 310-311 | 2 | |
| α-helix | 312-329 | 18 | |
| α-helix | 333-335 | 3 | |
| α-helix | 336-344 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 802 | 1 | 6 |
| β-strand | 804 | 1 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hypoxia-inducible factor 1 alpha inhibitor | A | protein | 349 | Homo sapiens | Q9NWT6 (AlphaFold model) |
| Hypoxia-inducible factor 1 alpha | B | protein | 19 |
>3D8C_1 Hypoxia-inducible factor 1 alpha inhibitor (chains A) MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEE PVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNR EEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWG QLTSNLLLIGMEGNVTPAHYGEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQS QVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGA PTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
>3D8C_2 HYPOXIA-INDUCIBLE FACTOR 1 ALPHA (chains B) DESGLPQLTSYDCEVNAPI
Water and common crystallization additives (SO4, GOL) are not listed.
Evidence that two enzyme-derived histidine ligands are sufficient for iron binding and catalysis by factor inhibiting HIF (FIH). Hewitson, K.S., Holmes, S.L., Ehrismann, D. et al. J Biol Chem (2008) 283:25971-25978. DOI 10.1074/jbc.M804999200 · PubMed
Other PDB entries of the same protein (UniProt Q9NWT6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3D8C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.