Crystal structure of the Drosophila kinesin family member NOD in complex with AMPPNP. Determined by X-ray diffraction at 2.5 Å resolution. Released 10 Feb 2009.
Explore 3DCB in 3D Show helices and sheets RCSB PDB PDBe
3DCB contains 17 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-15 | 8 | 1 |
| α-helix | 16-20 | 5 | |
| β-strand | 21 | 1 | 2 |
| β-strand | 24 | 1 | 2 |
| α-helix | 26-28 | 3 | |
| β-strand | 30-31 | 2 | 3 |
| β-strand | 40-43 | 4 | 3 |
| β-strand | 46-49 | 4 | 3 |
| β-strand | 52-54 | 3 | 1 |
| α-helix | 60-67 | 8 | |
| α-helix | 69-77 | 9 | |
| β-strand | 81-87 | 7 | 1 |
| α-helix | 93-97 | 5 | |
| α-helix | 102-104 | 3 | |
| α-helix | 107-109 | 3 | |
| α-helix | 112-125 | 14 | |
| α-helix | 126-128 | 3 | |
| β-strand | 136-144 | 9 | 1 |
| β-strand | 149-151 | 3 | 1 |
| α-helix | 163-166 | 4 | |
| β-strand | 172-174 | 3 | 1 |
| α-helix | 179-188 | 10 | |
| β-strand | 206-214 | 9 | 1 |
| β-strand | 219-226 | 8 | 1 |
| α-helix | 227-229 | 3 | |
| α-helix | 251-262 | 12 | |
| α-helix | 272-274 | 3 | |
| α-helix | 276-280 | 5 | |
| β-strand | 290-297 | 8 | 1 |
| α-helix | 301-303 | 3 | |
| α-helix | 304-319 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Kinesin-like protein Nod | A | protein | 344 | Drosophila melanogaster | P18105 (AlphaFold model) |
>3DCB_1 Kinesin-like protein Nod (chains A) MASDYKDDDDKRRRGMEGAKLSAVRIAVREAPYRQFLGRREPSVVQFPPWSDGKSLIVDQ NEFHFDHAFPATISQDEMYQALILPLVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEI LPEHLGILPRALGDIFERVTARQENNKDAIQVYASFIEIYNEKPFDLLGSTPHMPMVAAR CQRCTCLPLHSQADLHHILELGTRNRRVRPTNMNSNSSRSHAIVTIHVKSKTHHSRMNIV DLAGSEGVRRTGHEGVARQEGVNINLGLLSINKVVMSMAAGHTVIPYRDSVLTTVLQASL TAQSYLTFLACISPHQCDLSETLSTLRFGTSAKAAALEHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| ANP | Phosphoaminophosphonic acid-adenylate ester | C10 H17 N6 O12 P3 | 1 |
| MG | Magnesium ion | Mg | 1 |
ATPase cycle of the nonmotile kinesin NOD allows microtubule end tracking and drives chromosome movement. Cochran, J.C., Sindelar, C.V., Mulko, N.K. et al. Cell (2009) 136:110-122. DOI 10.1016/j.cell.2008.11.048 · PubMed
Other PDB entries of the same protein (UniProt P18105 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3DCB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.