3DS2: HIV-1 capsid C-terminal domain mutant

HIV-1 capsid C-terminal domain mutant (Y169A). Determined by X-ray diffraction at 1.2 Å resolution. Released 2 Sept 2008.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: Human immunodeficiency virus 1
Chains: 2
Atoms: 1,525
Mol. weight: 18.88 kDa
Released: 2 Sept 2008

Explore 3DS2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DS2 contains 13 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	150-152	3
α-helix	161-174	14
α-helix	179-185	7
α-helix	186-190	5
α-helix	196-205	10
α-helix	211-218	8

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	150-152	3
α-helix	161-174	14
α-helix	179-185	7
α-helix	186-190	5
α-helix	191-192	2
α-helix	196-205	10
α-helix	211-218	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HIV-1 capsid protein	A, B	protein	86	Human immunodeficiency virus 1	P12497

Sequence of entity 1 (A, B), FASTA

>3DS2_1 HIV-1 CAPSID PROTEIN (chains A, B)
SPTSILDIRQGPKEPFRDYVDRFAKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKAL
GPGATLEEMMTACQGVGGPGHKARVL

Primary citation

Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein. Bartonova, V., Igonet, S., Sticht, J. et al. J Biol Chem (2008) 283:32024-32033. DOI 10.1074/jbc.M804230200 · PubMed

Other PDB entries of the same protein (UniProt P12497), best resolution first:

3DS4 1.12 Å, HIV-1 capsid C-terminal domain mutant (L211S) in complex with an inhibitor of particle…
6T6E 1.3 Å, Crystal Structure of the C-terminal domain of the HIV-1 Integrase (PNL4-3)
2XDE 1.4 Å, Crystal structure of the complex of PF-3450074 with an engineered HIV capsid N terminal…
3L3U 1.4 Å, Crystal structure of the HIV-1 integrase core domain to 1.4A
2PWO 1.45 Å, Crystal Structure of HIV-1 CA146 A92E Psuedo Cell
3WNF 1.45 Å, Cyclic hexapeptide CKIDNC in complex with HIV-1 integrase
6OYD 1.46 Å, X-ray crystal structure of wild type HIV-1 protease in complex with GRL-004
6MCR 1.48 Å, X-ray crystal structure of wild type HIV-1 protease in complex with GRL-001
2PXR 1.5 Å, Crystal Structure of HIV-1 CA146 in the Presence of CAP-1
3WNH 1.5 Å, Cyclic hexapeptide PKZDNv in complex with HIV-1 integrase
4NX4 1.5 Å, Re-refinement of CAP-1 HIV-CA complex
6MCS 1.52 Å, X-ray crystal structure of wild type HIV-1 protease in complex with GRL-003

Browse structure collections

About this viewer

MolViewer shows 3DS2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.