3DTP: Myosin-11,Myosin-7

Tarantula heavy meromyosin obtained by flexible docking to Tarantula muscle thick filament Cryo-EM 3D-MAP. Determined by electron microscopy at 20.0 Å resolution. Released 7 Oct 2008.

Method: Electron microscopy
Resolution: 20.0 Å
Organisms: Gallus gallus, Homo sapiens, Avicularia avicularia
Chains: 6
Atoms: 20,580
Mol. weight: 301.07 kDa
Released: 7 Oct 2008

Explore 3DTP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DTP contains 137 α-helices and 75 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 50 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	4-7	4
α-helix	10-12	3
α-helix	24-27	4
α-helix	28-30	3
β-strand	34-39	6	1
β-strand	43-53	11	1
β-strand	56-61	6	1
β-strand	67-71	5	1
β-strand	76-77	2	1
α-helix	78-80	3
α-helix	81-83	3
β-strand	88	1	2
α-helix	89-91	3
α-helix	97-100	4
α-helix	102-104	3
α-helix	105-108	4
β-strand	114-117	4	2
β-strand	120-124	5	2
α-helix	135-140	6
α-helix	146-148	3
α-helix	154-164	11
α-helix	169-170	2
β-strand	171-176	6	2
α-helix	185-197	13
α-helix	220-223	4
β-strand	237	1	3
β-strand	245	1	3
β-strand	250-251	2	4
β-strand	252-253	2	2
β-strand	254-256	3	5
β-strand	262-265	4	5
β-strand	268-269	2	4
α-helix	276-278	3
α-helix	280-281	2
β-strand	287	1	3
α-helix	289-295	7
α-helix	299-304	6
α-helix	328-337	10
α-helix	338-340	3
α-helix	346-353	8
α-helix	357-360	4
α-helix	381-389	9
α-helix	395-403	9
β-strand	406	1	6
β-strand	415	1	6
α-helix	420-426	7
α-helix	434-437	4
α-helix	439-447	9
β-strand	459	1	5
β-strand	461-465	5	2
α-helix	466-468	3
α-helix	477-494	18
α-helix	495-499	5
α-helix	500-507	8
α-helix	522-529	8
α-helix	537-545	9
α-helix	552-562	11
β-strand	569-571	3	7
β-strand	580-585	6	7
β-strand	588-593	6	7
α-helix	598-601	4
α-helix	607-614	8
α-helix	659-674	16
β-strand	678-685	8	2
α-helix	698-708	11
α-helix	710-719	10
β-strand	725	1	8
α-helix	728-731	4
α-helix	736-738	3
α-helix	749-758	10
β-strand	767-769	3	8
β-strand	774-776	3	8
α-helix	781-790	10
α-helix	797-811	15
α-helix	813-830	18
α-helix	831-835	5
β-strand	843	1	9
α-helix	855-875	21
α-helix	878-968	91

Chain B: 41 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	10-13	4
α-helix	23-27	5
α-helix	28-30	3
β-strand	34-38	5	10
β-strand	44-53	10	10
β-strand	56-61	6	10
β-strand	67-71	5	10
β-strand	76-77	2	10
α-helix	81-83	3
β-strand	88	1	11
α-helix	97-109	13
β-strand	115-116	2	11
β-strand	121-122	2	11
β-strand	124	1	12
α-helix	135-139	5
α-helix	153-167	15
β-strand	171-175	5	11
α-helix	183-197	15
α-helix	219-231	13
β-strand	236-237	2	13
β-strand	245-246	2	13
β-strand	248-251	4	14
β-strand	252-256	5	11
β-strand	262-265	4	11
β-strand	268-272	5	14
α-helix	275-277	3
β-strand	287	1	13
α-helix	289-295	7
α-helix	299-304	6
α-helix	328-342	15
α-helix	348-361	14
α-helix	362-364	3
α-helix	382-391	10
α-helix	395-403	9
β-strand	406-407	2	15
β-strand	414-415	2	15
α-helix	417-419	3
α-helix	420-450	31
β-strand	459-464	6	11
α-helix	477-493	17
α-helix	494-500	7
α-helix	501-508	8
α-helix	522-529	8
α-helix	537-544	8
α-helix	552-562	11
β-strand	569-571	3	16
β-strand	580-583	4	16
β-strand	590-593	4	16
α-helix	597-602	6
α-helix	607-614	8
α-helix	619-625	7
α-helix	659-671	13
α-helix	673-675	3
β-strand	678-682	5	11
β-strand	685	1	12
α-helix	698-707	10
α-helix	710-717	8
β-strand	723-725	3	17
α-helix	727-734	8
α-helix	735-738	4
α-helix	749-758	10
β-strand	767-769	3	17
β-strand	774-776	3	17
α-helix	780-791	12
α-helix	793-797	5
α-helix	798-811	14
α-helix	819-830	12
α-helix	832-834	3
α-helix	857-972	116

Chain C: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	5-17	13
β-strand	26-27	2	18
α-helix	31-38	8
α-helix	44-51	8
α-helix	56-61	6
β-strand	63-64	2	18
α-helix	66-77	12
α-helix	85-93	9
β-strand	102-104	3	19
α-helix	105-111	7
α-helix	121-128	8
β-strand	132	1	19
β-strand	137-139	3	19
α-helix	140-148	9

Chain D: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	5-16	12
β-strand	26-27	2	20
α-helix	30-37	8
α-helix	44-51	8
α-helix	56-61	6
β-strand	63-64	2	20
α-helix	66-77	12
α-helix	85-93	9
β-strand	103-104	2	21
α-helix	105-114	10
α-helix	121-128	8
β-strand	137-138	2	21
α-helix	140-148	9

Chain E: 14 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	12-15	4
α-helix	18-21	4
α-helix	36-39	4
α-helix	56-66	11
β-strand	73	1	22
α-helix	76-84	9
α-helix	89-91	3
α-helix	92-99	8
β-strand	107	1	22
α-helix	108-117	10
α-helix	123-124	2
α-helix	125-133	9
β-strand	143	1	23
α-helix	144-153	10
α-helix	160-168	9
β-strand	172-173	2	23
β-strand	176-177	2	23
α-helix	179-187	9
β-strand	192	1	9

Chain F: 14 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
α-helix	34-36	3
α-helix	37-40	4
α-helix	57-59	3
α-helix	60-63	4
α-helix	76-78	3
α-helix	82-85	4
α-helix	95-98	4
α-helix	99-101	3
α-helix	108-118	11
α-helix	128-133	6
β-strand	142-143	2	24
α-helix	144-153	10
α-helix	160-168	9
β-strand	172	1	24
β-strand	176-177	2	24
α-helix	179-184	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin-11,Myosin-7	A	protein	971	Gallus gallus, Homo sapiens	P10587 (AlphaFold model), P12883 (AlphaFold model)
Myosin-11,Myosin-7	B	protein	973	Gallus gallus, Homo sapiens	P10587 (AlphaFold model), P12883 (AlphaFold model)
Myosin light polypeptide 6	C, D	protein	150	Gallus gallus	P02607 (AlphaFold model)
Myosin II regulatory light chain	E, F	protein	196	Avicularia avicularia	B4XT43 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3DTP_1 Myosin-11,Myosin-7 (chains A)
AQKPLSDDEKFLFVDKNFVNNPLAQADWSAKKLVWVPSEKHGFEAASIKEEKGDEVTVEL
QENGKKVTLSKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFC
VVINPYKQLPIYSEKIIDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGA
GKTENTKKVIQYLAVVASSHKGKKDTSITQGPSFSYGELEKQLLQANPILEAFGNAKTVK
NDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDERTFHIFYYLIAGASEQM
RNDLLLEGFNNYTFLSNGHVPIPAQQDDEMFQETLEAMTIMGFTEEEQTSILRVVSSVLQ
LGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDVVQKAQTKE
QADFAIEALAKAKFERLFRWILTRVNKALDKTKRQGASFLGILDIAGFEIFEINSFEQLC
INYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPTNPPGVLALL
DEECWFPKATDTSFVEKLIQEQGNHAKFQKSKQLKDKTEFCILHYAGKVTYNASAWLTKN
MDPLNDNVTSLLNQSSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQ
LYKEQLTKLMTTLRNTNPNFVRCIIPNHEKRAGKLDAHLVLEQLRCNGVLEGIRICRQGF
PNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVL
AHLEEERDLKITDVIIAFQAQCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWW
RLFTKVKPLLQSAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQ
VQAEQDNLADAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSEL
KRDIDDLELTL

Sequence of entity 2 (B), FASTA

>3DTP_2 Myosin-11,Myosin-7 (chains B)
AQKPLSDDEKFLFVDKNFVNNPLAQADWSAKKLVWVPSEKHGFEAASIKEEKGDEVTVEL
QENGKKVTLSKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFC
VVINPYKQLPIYSEKIIDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGA
GKTENTKKVIQYLAVVASSHKGKKDTSITQGPSFSYGELEKQLLQANPILEAFGNAKTVK
NDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDERTFHIFYYLIAGASEQM
RNDLLLEGFNNYTFLSNGHVPIPAQQDDEMFQETLEAMTIMGFTEEEQTSILRVVSSVLQ
LGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDVVQKAQTKE
QADFAIEALAKAKFERLFRWILTRVNKALDKTKRQGASFLGILDIAGFEIFEINSFEQLC
INYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPTNPPGVLALL
DEECWFPKATDTSFVEKLIQEQGNHAKFQKSKQLKDKTEFCILHYAGKVTYNASAWLTKN
MDPLNDNVTSLLNQSSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQ
LYKEQLTKLMTTLRNTNPNFVRCIIPNHEKRAGKLDAHLVLEQLRCNGVLEGIRICRQGF
PNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVL
AHLEEERDLKITDVIIAFQAQCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWW
RLFTKVKPLLQSAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQ
VQAEQDNLADAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSEL
KRDIDDLELTLAK

Sequence of entity 3 (C, D), FASTA

>3DTP_3 Myosin light polypeptide 6 (chains C, D)
CDFSEEQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVMKVLGNPKSDEMN
LKTLKFEQFLPMMQTIAKNKDQGCFEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMT
EEEVEQLVAGHEDSNGCINYEELVRMVLSG

Sequence of entity 4 (E, F), FASTA

>3DTP_4 Myosin II regulatory light chain (chains E, F)
MGDDEKKEKKKKSKKKAEEEGGDAPAAPPAPKPPSQKRRAQRSGSNVFAMFTQHQVQEFK
EAFQLIDQDKDGFISKNDIRATFDSLGRLCTEQELDSMVAEAPGPINFTMFLTIFGDRIA
GTDEEDVIVNAFNLFDEGDGKCKEETLKRSLTTWGEKFSQDEVDQALSEAPIDGNGLIDI
KKFAQILTKGAKEEGA

Primary citation

Three-Dimensional Reconstruction of Tarantula Myosin Filaments Suggests How Phosphorylation May Regulate Myosin Activity. Alamo, L., Wriggers, W., Pinto, A. et al. J Mol Biol (2008) 384:780-797. DOI 10.1016/j.jmb.2008.10.013 · PubMed

Other PDB entries of the same protein (UniProt P10587 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M05 2.67 Å, Chicken smooth muscle myosin motor domain co-crystallized with the specific CK-571…
5T45 2.8 Å, Chicken smooth muscle myosin motor domain co-crystallized with the specific CK-571…
1BR2 2.9 Å, Smooth muscle myosin motor domain complexed with MGADP.ALF4
7MF3 3.4 Å, Structure of the autoinhibited state of smooth muscle myosin-2
1BR1 3.5 Å, Smooth muscle myosin motor domain-essential light chain complex with MGADP.ALF4 bound at…
1BR4 3.62 Å, Smooth muscle myosin motor domain-essential light chain complex with MGADP.BEF3 bound at…
6BIH 6.0 Å, The Structure of the Actin-Smooth Muscle Myosin Motor Domain Complex in the Rigor State
8SYF 19.0 Å, Homology model of Acto-HMM complex in ADP-state. Chicken smooth muscle HMM and chicken…
1I84 20.0 Å, cryo-EM structure of the heavy meromyosin subfragment of chicken gizzard smooth muscle…
3J04 20.0 Å, EM structure of the heavy meromyosin subfragment of Chick smooth muscle Myosin with…

Browse structure collections

About this viewer

MolViewer shows 3DTP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.