Crystal structure of SAG506-01, orthorhombic, twinned, crystal 2. Determined by X-ray diffraction at 1.95 Å resolution. Released 2 Dec 2008.
Explore 3DUU in 3D Show helices and sheets RCSB PDB PDBe
3DUU contains 7 α-helices and 53 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-5 | 2 | 1 |
| β-strand | 10-13 | 4 | 2 |
| β-strand | 18-25 | 8 | 1 |
| β-strand | 27C-27D | 2 | 3 |
| β-strand | 30-31 | 2 | 3 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-76 | 7 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| β-strand | 96-97 | 2 | 2 |
| β-strand | 101-105 | 5 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 4 |
| β-strand | 10-12 | 3 | 5 |
| β-strand | 17-25 | 9 | 4 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-39 | 7 | 6 |
| β-strand | 46-51 | 6 | 6 |
| β-strand | 57-59 | 3 | 6 |
| β-strand | 64 | 1 | 4 |
| β-strand | 67-72 | 6 | 4 |
| β-strand | 77-82A | 7 | 4 |
| β-strand | 89-95 | 7 | 6 |
| β-strand | 102-103 | 2 | 6 |
| β-strand | 107-108 | 2 | 6 |
| β-strand | 109-111 | 3 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-7 | 3 | 7 |
| β-strand | 10-13 | 4 | 8 |
| β-strand | 19-24 | 6 | 7 |
| β-strand | 27C-27D | 2 | 9 |
| β-strand | 30-31 | 2 | 9 |
| β-strand | 33-38 | 6 | 8 |
| β-strand | 45-49 | 5 | 8 |
| β-strand | 53-54 | 2 | 8 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 7 |
| β-strand | 70-75 | 6 | 7 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 8 |
| β-strand | 96-97 | 2 | 8 |
| β-strand | 101-105 | 5 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 10 |
| β-strand | 11-12 | 2 | 11 |
| β-strand | 18-25 | 8 | 10 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-39 | 7 | 12 |
| β-strand | 46-51 | 6 | 12 |
| β-strand | 57-59 | 3 | 12 |
| β-strand | 64 | 1 | 13 |
| β-strand | 67 | 1 | 13 |
| β-strand | 68-72 | 5 | 10 |
| β-strand | 77-82 | 6 | 10 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-95 | 8 | 12 |
| β-strand | 103 | 1 | 12 |
| β-strand | 107-109 | 3 | 12 |
| β-strand | 110-111 | 2 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| antibody Fv fragment SAG506-01 | A, C | protein | 112 | Mus Musculus | A0N262 (AlphaFold model) |
| Ig-like protein | B, D | protein | 121 | Mus Musculus | A2NU21 (AlphaFold model) |
>3DUU_1 antibody Fv fragment SAG506-01 (chains A, C) DIVLTQSPSSLAVSAGERVTMSCKSSQSLFKSRNQKNYLAWYQQKPGQSPKLLIYWASTR ESGVPDRFTGSGSGTDFTLTINGVQAEDLAVYYCKQSYNLRTFGGGTKLELK
>3DUU_2 Ig-like protein (chains B, D) EVKLVESGGGLVQPGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTV EYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDGYYVDAMDYWGQGTSVTVS S
Water and common crystallization additives (PG4) are not listed.
Pseudo-symmetry and twinning in crystals of homologous antibody Fv fragments. Brooks, C.L., Blackler, R.J., Gerstenbruch, S. et al. Acta Crystallogr D Biol Crystallogr (2008) 64:1250-1258. DOI 10.1107/S0907444908033453 · PubMed
Other PDB entries of the same protein (UniProt A0N262 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3DUU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.