Crystal structure of SAG506-01, tetragonal, crystal 2. Determined by X-ray diffraction at 1.95 Å resolution. Released 2 Dec 2008.
Explore 3DV6 in 3D Show helices and sheets RCSB PDB PDBe
3DV6 contains 5 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-13 | 4 | 2 |
| β-strand | 18-25 | 8 | 1 |
| β-strand | 27C-27D | 2 | 3 |
| β-strand | 30-31 | 2 | 3 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-76 | 7 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| β-strand | 96-97 | 2 | 2 |
| β-strand | 101-105 | 5 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 4 |
| β-strand | 10-12 | 3 | 5 |
| β-strand | 18-25 | 8 | 4 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-39 | 7 | 5 |
| β-strand | 46-51 | 6 | 5 |
| α-helix | 52B-53 | 3 | |
| β-strand | 57-59 | 3 | 5 |
| β-strand | 64 | 1 | 4 |
| β-strand | 67-72 | 6 | 4 |
| β-strand | 77-82 | 6 | 4 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-95 | 8 | 5 |
| β-strand | 102-103 | 2 | 5 |
| β-strand | 107-111 | 5 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| antibody Fv fragment SAG506-01 | A | protein | 112 | Mus Musculus | A0N262 (AlphaFold model) |
| Ig-like protein | B | protein | 121 | Mus Musculus | A2NU21 (AlphaFold model) |
>3DV6_1 antibody Fv fragment SAG506-01 (chains A) DIVLTQSPSSLAVSAGERVTMSCKSSQSLFKSRNQKNYLAWYQQKPGQSPKLLIYWASTR ESGVPDRFTGSGSGTDFTLTINGVQAEDLAVYYCKQSYNLRTFGGGTKLELK
>3DV6_2 Ig-like protein (chains B) EVKLVESGGGLVQPGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTV EYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDGYYVDAMDYWGQGTSVTVS S
Water and common crystallization additives (PG4) are not listed.
Pseudo-symmetry and twinning in crystals of homologous antibody Fv fragments. Brooks, C.L., Blackler, R.J., Gerstenbruch, S. et al. Acta Crystallogr D Biol Crystallogr (2008) 64:1250-1258. DOI 10.1107/S0907444908033453 · PubMed
Other PDB entries of the same protein (UniProt A0N262 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3DV6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.