3DWD: ArfGAP domain of human ARFGAP1

Crystal structure of the ArfGAP domain of human ARFGAP1. Determined by X-ray diffraction at 2.4 Å resolution. Released 5 Aug 2008.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,772
Mol. weight: 33.83 kDa
Ligands: ZN
Released: 5 Aug 2008

Explore 3DWD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DWD contains 13 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	4-14	11
β-strand	21	1	1
β-strand	28	1	1
β-strand	32-34	3	2
β-strand	39-41	3	2
α-helix	43-52	10
β-strand	59-61	3	2
α-helix	69-77	9
α-helix	80-88	9
α-helix	99-103	5
α-helix	106-119	14

Chain B: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	4-14	11
β-strand	21	1	3
β-strand	28	1	3
β-strand	32-34	3	4
α-helix	35-37	3
β-strand	39-41	3	4
α-helix	43-49	7
β-strand	59-61	3	4
α-helix	69-77	9
α-helix	80-88	9
α-helix	99-103	5
α-helix	106-119	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP-ribosylation factor GTPase-activating protein 1	A, B	protein	147	Homo sapiens	Q8N6T3 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3DWD_1 ADP-ribosylation factor GTPase-activating protein 1 (chains A, B)
MGSSHHHHHHSSGLVPRGSMASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWI
CLECSGRHRGLGVHLSFVRSVTMDKWKDIELEKMKAGGNAKFREFLESQEDYDPCWSLQE
KYNSRAAALFRDKVVALAEGREWSLES

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (UNX) are not listed.

Primary citation

Crystal structure of the ArfGAP domain of human ARFGAP1. Nedyalkova, L., Tong, Y., Tempel, W. et al. To be published.

Other PDB entries of the same protein (UniProt Q8N6T3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3O47 2.8 Å, Crystal structure of ARFGAP1-ARF1 fusion protein

Browse structure collections

About this viewer

MolViewer shows 3DWD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.