Structure of murine INOS oxygenase domain with inhibitor AR-C130232. Determined by X-ray diffraction at 2.2 Å resolution. Released 7 Oct 2008.
Explore 3E68 in 3D Show helices and sheets RCSB PDB PDBe
3E68 contains 53 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 79-82 | 4 | 1 |
| β-strand | 89-92 | 4 | 1 |
| α-helix | 94-97 | 4 | |
| α-helix | 117-119 | 3 | |
| β-strand | 120 | 1 | 2 |
| α-helix | 130-146 | 17 | |
| α-helix | 153-170 | 18 | |
| α-helix | 177-189 | 13 | |
| α-helix | 197-199 | 3 | |
| β-strand | 204-207 | 4 | 3 |
| α-helix | 214-229 | 16 | |
| α-helix | 230-232 | 3 | |
| β-strand | 237-240 | 4 | 3 |
| α-helix | 242-244 | 3 | |
| β-strand | 252-253 | 2 | 4 |
| β-strand | 257 | 1 | 3 |
| β-strand | 261 | 1 | 5 |
| β-strand | 263-265 | 3 | 6 |
| β-strand | 271-273 | 3 | 6 |
| α-helix | 275-277 | 3 | |
| α-helix | 278-286 | 9 | |
| α-helix | 297 | 1 | |
| β-strand | 298 | 1 | 5 |
| α-helix | 299-300 | 2 | |
| β-strand | 301-304 | 4 | 4 |
| α-helix | 309 | 1 | |
| β-strand | 310-313 | 4 | 4 |
| α-helix | 317-319 | 3 | |
| β-strand | 322-324 | 3 | 7 |
| α-helix | 331-336 | 6 | |
| β-strand | 339-341 | 3 | 7 |
| β-strand | 345-346 | 2 | 3 |
| β-strand | 350-353 | 4 | 8 |
| β-strand | 356-358 | 3 | 8 |
| β-strand | 363-364 | 2 | 3 |
| β-strand | 367-368 | 2 | 9 |
| α-helix | 369-370 | 2 | |
| α-helix | 371-376 | 6 | |
| α-helix | 377-378 | 2 | |
| α-helix | 386-392 | 7 | |
| α-helix | 400-402 | 3 | |
| α-helix | 404-422 | 19 | |
| β-strand | 427-428 | 2 | 9 |
| α-helix | 430-448 | 19 | |
| α-helix | 455-458 | 4 | |
| α-helix | 464-466 | 3 | |
| α-helix | 468-471 | 4 | |
| β-strand | 482-484 | 3 | 8 |
| β-strand | 485 | 1 | 2 |
| α-helix | 489-492 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 79-82 | 4 | 10 |
| β-strand | 89-92 | 4 | 10 |
| α-helix | 94-97 | 4 | |
| α-helix | 117-119 | 3 | |
| β-strand | 120 | 1 | 11 |
| α-helix | 130-145 | 16 | |
| α-helix | 153-170 | 18 | |
| α-helix | 177-189 | 13 | |
| α-helix | 197-199 | 3 | |
| β-strand | 204-207 | 4 | 12 |
| α-helix | 214-229 | 16 | |
| α-helix | 230-232 | 3 | |
| β-strand | 237-240 | 4 | 12 |
| β-strand | 252-253 | 2 | 13 |
| β-strand | 257 | 1 | 12 |
| β-strand | 261 | 1 | 14 |
| β-strand | 263-265 | 3 | 15 |
| β-strand | 271-273 | 3 | 15 |
| α-helix | 275-277 | 3 | |
| α-helix | 278-286 | 9 | |
| α-helix | 297 | 1 | |
| β-strand | 298 | 1 | 14 |
| α-helix | 299-300 | 2 | |
| β-strand | 301-304 | 4 | 13 |
| α-helix | 309-310 | 2 | |
| β-strand | 311-313 | 3 | 13 |
| α-helix | 317-319 | 3 | |
| β-strand | 322-324 | 3 | 16 |
| α-helix | 331-336 | 6 | |
| β-strand | 339-341 | 3 | 16 |
| β-strand | 345-346 | 2 | 12 |
| β-strand | 350-353 | 4 | 17 |
| β-strand | 356-358 | 3 | 17 |
| β-strand | 363-364 | 2 | 12 |
| β-strand | 367-368 | 2 | 18 |
| α-helix | 369-370 | 2 | |
| α-helix | 371-376 | 6 | |
| α-helix | 377-378 | 2 | |
| α-helix | 386-392 | 7 | |
| α-helix | 400-402 | 3 | |
| α-helix | 404-422 | 19 | |
| β-strand | 427-428 | 2 | 18 |
| α-helix | 430-448 | 19 | |
| α-helix | 455-458 | 4 | |
| α-helix | 464-466 | 3 | |
| α-helix | 468-471 | 4 | |
| β-strand | 482-484 | 3 | 17 |
| β-strand | 485 | 1 | 11 |
| α-helix | 489-491 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nitric oxide synthase, inducible | A, B | protein | 433 | Mus musculus | P29477 (AlphaFold model) |
>3E68_1 Nitric oxide synthase, inducible (chains A, B) LDKLHVTSTRPQYVRIKNWGSGEILHDTLHHKATSDFTCKSKSCLGSIMNPKSLTRGPRD KPTPLEELLPHAIEFINQYYGSFKEAKIEEHLARLEAVTKEIETTGTYQLTLDELIFATK MAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNNGNIRSAITVFPQRS DGKHDFRLWNSQLIRYAGYQMPDGTIRGDAATLEFTQLCIDLGWKPRYGRFDVLPLVLQA DGQDPEVFEIPPDLVLEVTMEHPKYEWFQELGLKWYALPAVANMLLEVGGLEFPACPFNG WYMGTEIGVRDFCDTQRYNILEEVGRRMGLETHTLASLWKDRAVTEINVAVLHSFQKQNV TIMDHHTASESFMKHMQNEYRARGGCPADWIWLVPPVSGSITPVFHQEMLNYVLSPFYYY QIEPWKTHIWQNE
| ID | Name | Formula | Copies |
|---|---|---|---|
| H4B | 5,6,7,8-tetrahydrobiopterin | C9 H15 N5 O3 | 2 |
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 2 |
| AT6 | N-[2-(6-amino-4-methylpyridin-2-yl)ethyl]-4-cyanobenzamide | C16 H16 N4 O | 2 |
| BOG | octyl beta-D-glucopyranoside | C14 H28 O6 | 2 |
Water and common crystallization additives (EDO, SO4) are not listed.
Anchored plasticity opens doors for selective inhibitor design in nitric oxide synthase. Garcin, E.D., Arvai, A.S., Rosenfeld, R.J. et al. Nat Chem Biol (2008) 4:700-707. DOI 10.1038/nchembio.115 · PubMed
Other PDB entries of the same protein (UniProt P29477 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3E68 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.