3E7A: Protein Phosphatase-1

Crystal Structure of Protein Phosphatase-1 Bound to the natural toxin Nodularin-R. Determined by X-ray diffraction at 1.63 Å resolution. Released 4 Nov 2008.

Method: X-ray diffraction
Resolution: 1.63 Å
Organisms: Homo sapiens, Nodularia spumigena
Chains: 4
Atoms: 5,652
Mol. weight: 72.42 kDa
Ligands: MN, AZI
Released: 4 Nov 2008

Explore 3E7A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3E7A contains 27 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	9-17	9
β-strand	20	1	1
β-strand	22	1	1
α-helix	32-48	17
β-strand	52-55	4	2
β-strand	59-62	4	3
β-strand	64	1	4
α-helix	69-79	11
β-strand	87-89	3	3
α-helix	100-113	14
β-strand	118-120	3	3
α-helix	121-123	3
α-helix	128-134	7
α-helix	136-143	8
α-helix	146-156	11
β-strand	162-165	4	2
β-strand	169-172	4	2
α-helix	184-187	4
α-helix	194-196	3
α-helix	200-206	7
β-strand	208-209	2	5
β-strand	216-218	3	5
β-strand	225-227	3	5
α-helix	229-239	11
β-strand	243-246	4	2
β-strand	255-258	4	2
β-strand	263-266	4	2
β-strand	267	1	4
α-helix	272-274	3
β-strand	280-285	6	3
β-strand	291-296	6	3

Chain B: 14 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	9-17	9
β-strand	20	1	6
β-strand	22	1	6
α-helix	32-48	17
β-strand	52-55	4	7
β-strand	59-62	4	3
β-strand	64	1	8
α-helix	69-79	11
β-strand	87-89	3	3
α-helix	100-113	14
β-strand	118-120	3	3
α-helix	121-123	3
α-helix	128-134	7
α-helix	136-143	8
α-helix	146-156	11
β-strand	162-165	4	7
β-strand	169-172	4	7
α-helix	184-187	4
α-helix	194-196	3
α-helix	200-206	7
β-strand	208-209	2	9
β-strand	216-218	3	9
β-strand	225-227	3	9
α-helix	229-239	11
β-strand	243-246	4	7
β-strand	255-258	4	7
β-strand	263-266	4	7
β-strand	267	1	8
α-helix	272-274	3
β-strand	280-285	6	3
β-strand	291-296	6	3
α-helix	297-298	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein phosphatase PP1-alpha catalytic subunit	A, B	protein	299	Homo sapiens	P62136 (AlphaFold model)
nodularin R	C, D	protein	5	Nodularia spumigena

Sequence of entity 1 (A, B), FASTA

>3E7A_1 Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (chains A, B)
GHMGSLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKI
CGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD

Sequence of entity 2 (C, D), FASTA

>3E7A_2 nodularin R (chains C, D)
DRXEX

Ligands and cofactors

ID	Name	Formula	Copies
MN	Manganese (II) ion	Mn	4
AZI	Azide ion	N3	2

Water and common crystallization additives (IOD, CL, GOL) are not listed.

Primary citation

Crystal structures of protein phosphatase-1 bound to nodularin-R and tautomycin: a novel scaffold for structure-based drug design of serine/threonine phosphatase inhibitors. Kelker, M.S., Page, R., Peti, W. J Mol Biol (2009) 385:11-21. DOI 10.1016/j.jmb.2008.10.053 · PubMed

Other PDB entries of the same protein (UniProt P62136 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZEG 1.09 Å, Structure of PP1-IRSp53 chimera [PP1(7-304) + linker (G/S)x9 + IRSp53(449-465)] bound to…
6ZEH 1.3 Å, Structure of PP1-spectrin alpha II chimera [PP1(7-304) + linker (G/S)x9 + spectrin alpha…
6ZEI 1.39 Å, Structure of PP1-IRSp53 S455E chimera [PP1(7-304) + linker (G/S)x9 + IRSp53(449-465)]…
6DNO 1.45 Å, Crystal structure of Protein Phosphatase 1 (PP1) bound to the muscle glycogen-targeting…
4MOV 1.45 Å, 1.45 A Resolution Crystal Structure of Protein Phosphatase 1
6OBR 1.5 Å, PP1 Y134A in complex with Microcystin LR
3E7B 1.7 Å, Crystal Structure of Protein Phosphatase-1 Bound to the natural toxin inhibitor Tautomycin
8SW6 1.76 Å, Protein Phosphatase 1 in complex with PP1-specific Phosphatase targeting peptide…
6ZEJ 1.78 Å, Structure of PP1-Phactr1 chimera [PP1(7-304) + linker (SGSGS) + Phactr1(526-580)]
7T0Y 1.8 Å, The Ribosomal RNA Processing 1B Protein Phosphatase-1 Holoenzyme
6OBS 1.8 Å, PP1 Y134K
6OBQ 1.84 Å, PP1 H66K in complex with Microcystin LR

Browse structure collections

About this viewer

MolViewer shows 3E7A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.