3E9F: Chromatin modification-related protein EAF3

Crystal structure short-form (residue1-113) of Eaf3 chromo domain. Determined by X-ray diffraction at 1.8 Å resolution. Released 4 Nov 2008.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 953
Mol. weight: 14.3 kDa
Released: 4 Nov 2008

Explore 3E9F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3E9F contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	1
β-strand	21-32	12	1
β-strand	37-40	4	1
β-strand	59	1	1
α-helix	60-62	3
β-strand	76-81	6	1
α-helix	86-88	3
β-strand	90-92	3	1
β-strand	97-98	2	1
α-helix	102-113	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromatin modification-related protein EAF3	A	protein	121	Saccharomyces cerevisiae	Q12432 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3E9F_1 Chromatin modification-related protein EAF3 (chains A)
MVDLEQEFALGGRCLAFHGPLMYEAKILKIWDPSSKMYTSIPNDKPGGSSQATKEIKPQK
LGEDESIPEEIINGKCFFIHYQGWKSSWDEWVGYDRIRAYNEENIAMKKRLANLEHHHHH
H

Primary citation

Molecular Basis of the Interaction of Saccharomyces cerevisiae Eaf3 Chromo Domain with Methylated H3K36. Sun, B., Hong, J., Zhang, P. et al. J Biol Chem (2008) 283:36504-36512. DOI 10.1074/jbc.M806564200 · PubMed

Other PDB entries of the same protein (UniProt Q12432 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8I3F 1.62 Å, Crystal structure of Rco1-Eaf3 with peptide of histone H3 N-terminal
8I3G 2.4 Å, Crystal structure of Eaf3-Eaf7 complex
3E9G 2.5 Å, Crystal structure long-form (residue1-124) of Eaf3 chromo domain
7YI1 2.8 Å, Cryo-EM structure of Eaf3 CHD bound to H3K36me3 nucleosome
8TOF 2.8 Å, Rpd3S bound to an H3K36Cme3 modified nucleosome
8KD3 2.9 Å, Rpd3S in complex with nucleosome with H3K36MLA modification, H3K9Q mutation and 187bp DNA
8KD5 2.9 Å, Rpd3S in complex with nucleosome with H3K36MLA modification and 187bp DNA, class2
8KD4 2.93 Å, Rpd3S in complex with nucleosome with H3K36MLA modification and 187bp DNA, class1
8HXX 3.0 Å, Cryo-EM structure of the histone deacetylase complex Rpd3S
8KD2 3.02 Å, Rpd3S in complex with 187bp nucleosome
8KD6 3.07 Å, Rpd3S in complex with nucleosome with H3K36MLA modification and 187bp DNA, class3
8KD7 3.09 Å, Rpd3S in complex with nucleosome with H3K36MLA modification and 167bp DNA

Browse structure collections

About this viewer

MolViewer shows 3E9F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.