3EE1: Effector protein virA

Novel fold of VirA, a type III secretion system effector protein from Shigella flexneri. Determined by X-ray diffraction at 3.01 Å resolution. Released 16 Dec 2008.

Method: X-ray diffraction
Resolution: 3.01 Å
Organism: Shigella flexneri
Chains: 2
Atoms: 5,244
Mol. weight: 89.73 kDa
Released: 16 Dec 2008

Explore 3EE1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EE1 contains 29 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	6-10	5
α-helix	62-64	3
β-strand	65-67	3	1
β-strand	77-83	7	1
β-strand	86-93	8	1
β-strand	96-100	5	1
β-strand	110-113	4	1
α-helix	116-123	8
β-strand	128-129	2	2
α-helix	134-135	2
β-strand	136-138	3	2
α-helix	152-160	9
β-strand	163-165	3	2
β-strand	171	1	3
α-helix	172-173	2
α-helix	182-191	10
β-strand	199-202	4	2
β-strand	205-207	3	2
α-helix	209-219	11
α-helix	229-232	4
α-helix	236-246	11
α-helix	252-264	13
α-helix	268-276	9
β-strand	286	1	3
α-helix	287-307	21
β-strand	319-326	8	2
β-strand	341-348	8	2
β-strand	351-353	3	2
β-strand	358-369	12	2
α-helix	377-383	7
α-helix	386-388	3
β-strand	390-397	8	2

Chain B: 14 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	6-10	5
α-helix	62-64	3
β-strand	65-67	3	4
β-strand	77-83	7	4
β-strand	86-93	8	4
β-strand	96-100	5	4
β-strand	110-113	4	4
α-helix	116-123	8
β-strand	128-129	2	5
β-strand	136-138	3	5
α-helix	152-160	9
β-strand	163-165	3	5
β-strand	171	1	6
α-helix	172-173	2
α-helix	182-191	10
β-strand	199-202	4	5
β-strand	205-207	3	5
α-helix	209-219	11
α-helix	229-235	7
α-helix	236-245	10
α-helix	252-264	13
α-helix	268-276	9
β-strand	286	1	6
α-helix	287-307	21
β-strand	319-326	8	5
β-strand	341-348	8	5
β-strand	351-353	3	5
β-strand	358-369	12	5
α-helix	377-383	7
α-helix	386-388	3
β-strand	390-397	8	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Effector protein virA	A, B	protein	400	Shigella flexneri	Q7BU69 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3EE1_1 Effector protein virA (chains A, B)
EVASYCDRVVAAVSSWMSTVKSTTEVSWNKLSFCDVLLKIITFGIYSPHETLAEKYSEKK
LMDSFSPSLSQDKMDGEFAHANIDGISIRLCLNKGICSVFYLDGDKIQSTQLSSKEYNNL
LSSLPPKQFNLGKVHTITAPVSGNFKTHKPAPEVIETAINCCTSIIPNDDYFPVKDTDFN
SVWHDIYRDIRASDSNSTKIYFNNIEIPLKLIADLINELGINEFIDSKKELQMLSYNQLN
KIINSNFPQQDLCFQTEKLLFTSLFQDPAFISALTSAFWQSLHITSSSVEHIYAQIMSEN
IENRLNFMPEQRVINNCGHIIKINAVVPKNDTAISASGGRAYEVSSSILPSHITCNGVGI
NKIETSYLVHAGTLPSSEGLRNAIPPESRQVSFAIISPDV

Primary citation

Novel fold of VirA, a type III secretion system effector protein from Shigella flexneri. Davis, J., Wang, J., Tropea, J.E. et al. Protein Sci (2008) 17:2167-2173. DOI 10.1110/ps.037978.108 · PubMed

Other PDB entries of the same protein (UniProt Q7BU69 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EB8 2.4 Å, VirA
4FMB 3.2 Å, VirA-Rab1 complex structure

Browse structure collections

About this viewer

MolViewer shows 3EE1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.