Solution structure of murine epidermal growth factor determined by NMR spectroscopy and refined by energy minimization with restraints. Determined by solution NMR. Released 31 Jan 1994.
Explore 3EGF in 3D Show helices and sheets RCSB PDB PDBe
3EGF contains 0 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 1 |
| β-strand | 19-23 | 5 | 1 |
| β-strand | 29-32 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Epidermal growth factor | A | protein | 53 | Mus musculus | P01132 (AlphaFold model) |
>3EGF_1 EPIDERMAL GROWTH FACTOR (chains A) NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Solution structure of murine epidermal growth factor determined by NMR spectroscopy and refined by energy minimization with restraints. Montelione, G.T., Wuthrich, K., Burgess, A.W. et al. Biochemistry (1992) 31:236-249. DOI 10.1021/bi00116a033 · PubMed
Other PDB entries of the same protein (UniProt P01132 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3EGF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.