3ENB: PRP8 core domain IV

Crystal Structure of PRP8 core domain IV. Determined by X-ray diffraction at 1.85 Å resolution. Released 7 Oct 2008.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,818
Mol. weight: 51.08 kDa
Released: 7 Oct 2008

Explore 3ENB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ENB contains 22 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	1777-1781	5	1
β-strand	1787-1792	6	2
α-helix	1797	1
β-strand	1798-1803	6	2
β-strand	1805-1810	6	1
β-strand	1816-1822	7	1
α-helix	1824-1826	3
α-helix	1833-1851	19
α-helix	1854-1856	3
β-strand	1860-1863	4	1
α-helix	1866-1868	3
α-helix	1869-1875	7
β-strand	1883-1886	4	1
α-helix	1893-1898	6
α-helix	1900-1908	9
β-strand	1913-1918	6	1
α-helix	1923-1925	3
α-helix	1929-1945	17
α-helix	1947-1953	7
α-helix	1973-1988	16

Chain B: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1777-1784	8	1
β-strand	1805-1810	6	1
β-strand	1816-1822	7	1
α-helix	1827-1829	3
α-helix	1838-1851	14
α-helix	1854-1856	3
β-strand	1860-1863	4	1
α-helix	1869-1875	7
β-strand	1883-1886	4	1
α-helix	1893-1898	6
α-helix	1900-1908	9
β-strand	1913-1918	6	1
α-helix	1923-1925	3
α-helix	1929-1945	17
α-helix	1947-1953	7
α-helix	1973-1987	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pre-mRNA-processing-splicing factor 8	A, B	protein	222	Homo sapiens	Q6P2Q9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3ENB_1 Pre-mRNA-processing-splicing factor 8 (chains A, B)
GELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWA
GQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSE
LQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNND
RAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD

Primary citation

Structural elucidation of a PRP8 core domain from the heart of the spliceosome. Ritchie, D.B., Schellenberg, M.J., Gesner, E.M. et al. Nat Struct Mol Biol (2008) 15:1199-1205. DOI 10.1038/nsmb.1505 · PubMed

Other PDB entries of the same protein (UniProt Q6P2Q9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JK8 1.15 Å, Open and closed forms of R1865A human PRP8 RNase H-like domain with bound Mg ion
4JKB 1.3 Å, Open and closed forms of V1788D human PRP8 RNase H-like domain with bound Mg ion
4JKA 1.32 Å, Open and closed forms of R1865A human PRP8 RNase H-like domain with bound Co ion
4JK7 1.4 Å, Open and closed forms of wild-type human PRP8 RNase H-like domain with bound Mg ion
4JK9 1.5 Å, Open and closed forms of wild-type human PRP8 RNase H-like domain with bound Co ion
4JKC 1.5 Å, Open and closed forms of T1800E human PRP8 RNase H-like domain with bound Mg ion
4JKD 1.55 Å, Open and closed forms of I1790Y human PRP8 RNase H-like domain with bound Mg ion
4JKE 1.65 Å, Open and closed forms of T1789P human PRP8 RNase H-like domain with bound Mg ion
4JKG 1.8 Å, Open and closed forms of mixed T1789P+R1865A and R1865A human PRP8 RNase H-like domain…
4JKH 1.8 Å, Open and closed forms of D1781E human PRP8 RNase H-like domain with bound Mg ion
3LRU 1.85 Å, hPRP8 Non-Native Subdomain
3E9L 1.95 Å, Crystal Structure of Human Prp8, Residues 1755-2016

Browse structure collections

About this viewer

MolViewer shows 3ENB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.