3EQ5: Ski-like protein

Crystal structure of fragment 137 to 238 of the human Ski-like protein. Determined by X-ray diffraction at 2.45 Å resolution. Released 27 Jan 2009.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: Homo sapiens
Chains: 12
Atoms: 9,437
Mol. weight: 168.01 kDa
Released: 27 Jan 2009

Explore 3EQ5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EQ5 contains 64 α-helices and 60 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	137-139	3
β-strand	145-149	5	1
β-strand	152-159	8	1
β-strand	162-166	5	1
α-helix	167-169	3
α-helix	170-174	5
α-helix	180-190	11
β-strand	195-196	2	1
α-helix	197-198	2
α-helix	199-207	9
β-strand	219-222	4	1
α-helix	223-234	12

Chains B and C: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	144-149	6	2
β-strand	152-159	8	2
β-strand	162-166	5	2
α-helix	167-169	3
α-helix	170-174	5
α-helix	180-190	11
β-strand	195-196	2	2
α-helix	199-207	9
β-strand	219-222	4	2
α-helix	223-234	12

Chains D, E and G: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	144-149	6	4
β-strand	152-159	8	4
β-strand	162-166	5	4
α-helix	167-169	3
α-helix	170-174	5
α-helix	180-189	10
β-strand	195-196	2	4
α-helix	199-207	9
β-strand	219-222	4	4
α-helix	223-234	12

Chain F: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	145-149	5	6
β-strand	152-159	8	6
β-strand	162-166	5	6
α-helix	167-173	7
α-helix	180-189	10
β-strand	195-196	2	6
α-helix	197-198	2
α-helix	199-207	9
β-strand	219-222	4	6
α-helix	223-234	12

Chain H: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	144-149	6	8
β-strand	152-158	7	8
β-strand	163-166	4	8
α-helix	167-173	7
α-helix	180-189	10
β-strand	195-196	2	8
α-helix	199-207	9
β-strand	219-222	4	8
α-helix	223-234	12

Chain I: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	145-149	5	9
β-strand	152-158	7	9
β-strand	163-166	4	9
α-helix	167-173	7
α-helix	180-189	10
α-helix	194	1
β-strand	195-196	2	9
α-helix	197-198	2
α-helix	199-207	9
β-strand	219-222	4	9
α-helix	223-234	12

Chain J: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	145-149	5	10
β-strand	152-159	8	10
β-strand	162-166	5	10
α-helix	167-172	6
α-helix	180-189	10
α-helix	192-194	3
β-strand	195-196	2	10
α-helix	199-207	9
β-strand	219-222	4	10
α-helix	223-234	12

Chain K: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	144-148	5	11
β-strand	153-158	6	11
β-strand	163-166	4	11
α-helix	167-171	5
α-helix	180-189	10
α-helix	194	1
β-strand	195-196	2	11
α-helix	197-198	2
α-helix	199-208	10
β-strand	219-222	4	11
α-helix	223-234	12

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ski-like protein	A, B, C, D, E, F, G, H, I, J, K, L	protein	125	Homo sapiens	P12757 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L), FASTA

>3EQ5_1 Ski-like protein (chains A, B, C, D, E, F, G, H, I, J, K, L)
MHHHHHHSSGVDLGTENLYFQSMPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNS
VLREFTLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNAL
LRPRT

Primary citation

Crystal structure of fragment 137 to 238 of the human Ski-like protein. Tresaugues, L., Wisniewska, M., Andersson, J. et al. To be published.

Other PDB entries of the same protein (UniProt P12757 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5C4V 2.6 Å, Ski-like protein

Browse structure collections

About this viewer

MolViewer shows 3EQ5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.