3ER0: Full length eIF5A from Saccharomyces cerevisiae

Crystal structure of the full length eIF5A from Saccharomyces cerevisiae. Determined by X-ray diffraction at 3.35 Å resolution. Released 2 Dec 2008.

Method: X-ray diffraction
Resolution: 3.35 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 2,105
Mol. weight: 36.8 kDa
Released: 2 Dec 2008

Explore 3ER0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ER0 contains 4 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	19-22	4	1
β-strand	31-34	4	2
β-strand	37-47	11	2
β-strand	56-63	8	2
β-strand	70-75	6	2
β-strand	79-82	4	1
β-strand	87-91	5	3
α-helix	92	1
α-helix	120-126	7
β-strand	135-141	7	3
β-strand	144-150	7	3

Chain B: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	19-22	4	4
β-strand	31-33	3	5
β-strand	38-46	9	5
β-strand	57-63	7	5
β-strand	70-74	5	5
β-strand	79-82	4	4
β-strand	87-91	5	6
α-helix	92	1
α-helix	120-126	7
β-strand	135-141	7	6
β-strand	144-150	7	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation initiation factor 5A-2	A, B	protein	167	Saccharomyces cerevisiae	P23301 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3ER0_1 Eukaryotic translation initiation factor 5A-2 (chains A, B)
MRGSHHHHHHMSDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTG
KHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTK
DDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD

Primary citation

Crystal structure of the full length eIF5A from Saccharomyces cerevisiae. Sanches, M., Dias, C.A.O., Aponi, L.H. et al. To be published.

Other PDB entries of the same protein (UniProt P23301 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AGX 2.4 Å, Yeast RQC complex in state with the RING domain of Ltn1 in the IN position
8BN3 2.4 Å, Yeast 80S, ES7s delta, eIF5A, Stm1 containing
8AAF 2.5 Å, Yeast RQC complex in state G
8AGT 2.6 Å, Yeast RQC complex in state F
8AGV 2.6 Å, Yeast RQC complex in state H
8AGZ 2.6 Å, Yeast RQC complex in state with the RING domain of Ltn1 in the OUT position
8AGU 2.7 Å, Yeast RQC complex in state E
6TNU 3.1 Å, Yeast 80S ribosome in complex with eIF5A and decoding A-site and P-site tRNAs.
5DAT 3.15 Å, Complex of yeast 80S ribosome with hypusine-containing eIF5A
8K2D 3.2 Å, Cryo-EM structure of the yeast 80S ribosome with tigecycline, eEF2, Stm1 and eIF5A
8UT0 3.22 Å, Eukaryotic 80S ribosome with Reh1, eIF5A and A/P site tRNA
5DC3 3.25 Å, Complex of yeast 80S ribosome with non-modified eIF5A

Browse structure collections

About this viewer

MolViewer shows 3ER0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.