3ERB: Complement C2

The Crystal Structure of C2b, a Fragment of Complement Component C2 produced during C3-convertase Formation. Determined by X-ray diffraction at 1.8 Å resolution. Released 10 Mar 2009.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,612
Mol. weight: 23.71 kDa
Released: 10 Mar 2009

Explore 3ERB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ERB contains 5 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	1
β-strand	14-17	4	2
α-helix	25	1
β-strand	26-30	5	2
β-strand	35-38	4	1
β-strand	41-44	4	2
β-strand	50-51	2	2
β-strand	63-66	4	1
β-strand	68-70	3	3
α-helix	71-72	2
β-strand	78-81	4	4
β-strand	86-88	3	3
β-strand	92-97	6	4
α-helix	98	1
β-strand	102-104	3	5
β-strand	108-110	3	4
β-strand	111	1	6
β-strand	117	1	6
β-strand	123-125	3	5
α-helix	132-133	2
β-strand	140-143	4	7
β-strand	152-157	6	7
β-strand	162-164	3	8
β-strand	168-170	3	7
β-strand	171	1	9
β-strand	177	1	9
β-strand	183-185	3	8
α-helix	187-191	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C2	A	protein	223	Homo sapiens	P06681 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3ERB_1 Complement C2 (chains A)
APSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPASRLCKSSGQWQTPGATRSLS
KAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDGFILRGSPVRQCRPNGMWDGE
TAVCDNGAGHCPNPGISLGAVRTGFRFGHGDKVRYRCSSNLVLTGSSERECQGNGVWSGT
EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGR

Primary citation

The structure of C2b, a fragment of complement component C2 produced during C3 convertase formation. Krishnan, V., Xu, Y., Macon, K. et al. Acta Crystallogr D Biol Crystallogr (2009) 65:266-274. DOI 10.1107/S0907444909000389 · PubMed

Other PDB entries of the same protein (UniProt P06681 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8ACF 1.8 Å, Structure of the argX-117 in complex with a complement C2 fragment at low pH
8ACI 1.85 Å, Structure of ARG-117 Fab in complex with a fragment of complement C2, neutral pH
2I6Q 2.1 Å, Complement component C2a
9ZCJ 2.6 Å, Therapeutic antibody with captured antigen
2I6S 2.7 Å, Complement component C2a
9U60 2.9 Å, C3 convertases zymogen C4b2 in loading state
9U5Z 3.1 Å, C3 convertases zymogen C4b2 in activation state
9U61 3.1 Å, CP/MBL pathways C3 convertase C4b2a and C3 complex
9QJ5 3.5 Å, Structure of the Complement classical and lectin pathway proconvertase, C4b2
9QK2 3.5 Å, Structure of the Complement classical and lectin pathway C3 convertase in complex with…
9QJ4 3.9 Å, Structure of the Complement classical and lectin pathway proconvertase, C4b2
9QPY 4.3 Å, Structure of the Complement classical and lectin pathway C3 convertase

Browse structure collections

About this viewer

MolViewer shows 3ERB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.