Crystal structure of yellow fever virus methyltransferase complexed with S-adenosyl-L-homocysteine. Determined by X-ray diffraction at 1.85 Å resolution. Released 6 Jan 2009.
Explore 3EVB in 3D Show helices and sheets RCSB PDB PDBe
3EVB contains 12 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-16 | 9 | |
| α-helix | 21-28 | 8 | |
| β-strand | 32-35 | 4 | 1 |
| α-helix | 38-45 | 8 | |
| β-strand | 53 | 1 | 2 |
| α-helix | 58-67 | 10 | |
| β-strand | 75-80 | 6 | 3 |
| α-helix | 86-92 | 7 | |
| β-strand | 97-103 | 7 | 3 |
| α-helix | 110-114 | 5 | |
| β-strand | 118 | 1 | 4 |
| α-helix | 121-123 | 3 | |
| β-strand | 124-127 | 4 | 3 |
| α-helix | 136-137 | 2 | |
| β-strand | 142-145 | 4 | 3 |
| α-helix | 154-172 | 19 | |
| β-strand | 178-183 | 6 | 3 |
| α-helix | 189-202 | 14 | |
| β-strand | 205-207 | 3 | 3 |
| β-strand | 219-222 | 4 | 3 |
| α-helix | 229-245 | 17 | |
| β-strand | 251-254 | 4 | 1 |
| α-helix | 255-257 | 3 | |
| β-strand | 258 | 1 | 2 |
| β-strand | 261 | 1 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| RNA-directed RNA polymerase NS5 | A | protein | 277 | Yellow fever virus | P03314 (AlphaFold model) |
>3EVB_1 RNA-directed RNA polymerase NS5 (chains A) MGSANGKTLGEVWKRELNLLDKRQFELYKRTDIVEVDRDTARRHLAEGKVDTGVAVSRGT AKLRWFHERGYVKLEGRVIDLGCGRGGWCYYAAAQKEVSGVKGFTLGRDGHEKPMNVQSL GWNIITFKDKTDIHRLEPVKCDTLLCDIGESSSSSVTEGERTVRVLDTVEKWLACGVDNF CVKVLAPYMPDVLEKLELLQRRFGGTVIRNPLSRNSTHEMYYVSGARSNVTFTVNQTSRL LMRRMRRPTGKVTLEADVILPIGTRSVGSSSHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| SAH | S-adenosyl-L-homocysteine | C14 H20 N6 O5 S | 1 |
Analysis of flavivirus NS5 methyltransferase cap binding. Geiss, B.J., Thompson, A.A., Andrews, A.J. et al. J Mol Biol (2009) 385:1643-1654. DOI 10.1016/j.jmb.2008.11.058 · PubMed
Other PDB entries of the same protein (UniProt P03314 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3EVB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.