Crystal structure of Dengue-2 virus methyltransferase complexed with S-adenosyl-L-homocysteine. Determined by X-ray diffraction at 2.2 Å resolution. Released 6 Jan 2009.
Explore 3EVG in 3D Show helices and sheets RCSB PDB PDBe
3EVG contains 13 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-18 | 10 | |
| α-helix | 22-30 | 9 | |
| β-strand | 34-37 | 4 | 1 |
| α-helix | 39-46 | 8 | |
| α-helix | 58-66 | 9 | |
| β-strand | 75-80 | 6 | 2 |
| α-helix | 86-92 | 7 | |
| β-strand | 97-103 | 7 | 2 |
| α-helix | 111-113 | 3 | |
| α-helix | 121-123 | 3 | |
| β-strand | 124-127 | 4 | 2 |
| α-helix | 132-134 | 3 | |
| β-strand | 142-145 | 4 | 2 |
| α-helix | 154-171 | 18 | |
| β-strand | 177-182 | 6 | 2 |
| α-helix | 188-201 | 14 | |
| β-strand | 204-206 | 3 | 2 |
| β-strand | 218-221 | 4 | 2 |
| α-helix | 228-241 | 14 | |
| α-helix | 242-244 | 3 | |
| α-helix | 250 | 1 | |
| β-strand | 251-254 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| RNA-directed RNA polymerase NS5 | A | protein | 275 | Dengue virus 2 16681-PDK53 | P29991 |
>3EVG_1 RNA-directed RNA polymerase NS5 (chains A) MTGNIGETLGEKWKSRLNALGKSEFQIYKKSGIQEVDRTLAKEGIKRGETDHHAVSRGSA KLRWFVERNMVTPEGKVVDLGCGRGGWSYYCGGLKNVREVKGLTKGGPGHEEPIPMSTYG WNLVRLQSGVDVFFIPPEKCDTLLCDIGESSPNPTVEAGRTLRVLNLVENWLNNNTQFCI KVLNPYMPSVIEKMEALQRKYGGALVRNPLSRNSTHEMYWVSNASGNIVSSVNMISRMLI NRFTMRYKKATYEPDVDLGSGTRNIGSSSHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| SAH | S-adenosyl-L-homocysteine | C14 H20 N6 O5 S | 1 |
Water and common crystallization additives (SO4) are not listed.
Analysis of flavivirus NS5 methyltransferase cap binding. Geiss, B.J., Thompson, A.A., Andrews, A.J. et al. J Mol Biol (2009) 385:1643-1654. DOI 10.1016/j.jmb.2008.11.058 · PubMed
Other PDB entries of the same protein (UniProt P29991), best resolution first:
MolViewer shows 3EVG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.