X-ray Structure of H5N1 NS1. Determined by X-ray diffraction at 2.7 Å resolution. Released 25 Nov 2008.
Explore 3F5T in 3D Show helices and sheets RCSB PDB PDBe
3F5T contains 6 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-25 | 20 | |
| α-helix | 30-50 | 21 | |
| α-helix | 54-66 | 13 | |
| β-strand | 85-86 | 2 | 1 |
| α-helix | 90-94 | 5 | |
| β-strand | 102-107 | 6 | 1 |
| β-strand | 110-115 | 6 | 1 |
| β-strand | 122-132 | 11 | 1 |
| β-strand | 135-146 | 12 | 1 |
| β-strand | 151-157 | 7 | 1 |
| α-helix | 166-182 | 17 | |
| β-strand | 186-189 | 4 | 1 |
| α-helix | 191-196 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nonstructural protein 1 | A | protein | 215 | Influenza virus | A5A5U1 |
>3F5T_1 Nonstructural protein 1 (chains A) MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRADQASLRGRGNTLGLDIETATRA GKQIVERILEGESDKALKMPASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIKMDQAIMD KTIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTGEDVKNAIGVLIGGL EWNDNTVRVTETIQRFAWRNSDEDGRLPLPPNQKR
X-ray structure of NS1 from a highly pathogenic H5N1 influenza virus. Bornholdt, Z.A., Prasad, B.V.V. Nature (2008) 456:985-988. DOI 10.1038/nature07444 · PubMed
Other PDB entries of the same protein (UniProt A5A5U1), best resolution first:
MolViewer shows 3F5T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.