Crystal Structure of Human IL-18 in complex with Ectromelia virus IL-18 Binding Protein. Determined by X-ray diffraction at 2.0 Å resolution. Released 6 Jan 2009.
Explore 3F62 in 3D Show helices and sheets RCSB PDB PDBe
3F62 contains 9 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 22-24 | 3 | |
| β-strand | 29-33 | 5 | 1 |
| β-strand | 36-43 | 8 | 1 |
| β-strand | 51-58 | 8 | 2 |
| α-helix | 63-65 | 3 | |
| β-strand | 66-67 | 2 | 2 |
| α-helix | 68-70 | 3 | |
| β-strand | 75-77 | 3 | 1 |
| α-helix | 78-80 | 3 | |
| β-strand | 81-85 | 5 | 1 |
| β-strand | 88-97 | 10 | 1 |
| β-strand | 106-114 | 9 | 2 |
| β-strand | 117-123 | 7 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-13 | 12 | 3 |
| α-helix | 18 | 1 | |
| β-strand | 19-22 | 4 | 3 |
| β-strand | 28-31 | 4 | 3 |
| α-helix | 43-45 | 3 | |
| β-strand | 47-54 | 8 | 3 |
| β-strand | 60-67 | 8 | 3 |
| β-strand | 71-75 | 5 | 3 |
| α-helix | 77-79 | 3 | |
| β-strand | 82-85 | 4 | 3 |
| α-helix | 87-89 | 3 | |
| β-strand | 91-92 | 2 | 3 |
| β-strand | 101-106 | 6 | 3 |
| β-strand | 109-117 | 9 | 3 |
| β-strand | 123-128 | 6 | 3 |
| β-strand | 135-140 | 6 | 3 |
| α-helix | 147-149 | 3 | |
| β-strand | 151-155 | 5 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interleukin 18 binding protein | A | protein | 109 | Ectromelia virus | Q85319 |
| Interleukin-18 | B | protein | 158 | Homo sapiens | Q14116 (AlphaFold model) |
>3F62_1 Interleukin 18 binding protein (chains A) GAMVETKCPNLDIVTSSGEFHCSGCVEHMPEFSYMYWLAKDMKSDEDTKFIEHLGDGINE DETVRTTDGGITTLRKVLHVTDTNKFAHYRFTCVLTTLDGVSKKNIWLK
>3F62_2 Interleukin-18 (chains B) GYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDSRDNAPRTIFIISMYKDSQPRG MAVTISVKSEKISTLSSENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSS YEGYFLASEKERDLFKLILKKEDELGDRSIMFTVQNED
Structural basis for antagonism of human interleukin 18 by poxvirus interleukin 18-binding protein. Krumm, B., Meng, X., Li, Y. et al. Proc Natl Acad Sci U S A (2008) 105:20711-20715. DOI 10.1073/pnas.0809086106 · PubMed
MolViewer shows 3F62 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.