Crystal Structure of Epstein-Barr virus gp42 protein. Determined by X-ray diffraction at 2.4 Å resolution. Released 23 Jun 2009.
Explore 3FD4 in 3D Show helices and sheets RCSB PDB PDBe
3FD4 contains 9 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 91-93 | 3 | |
| β-strand | 109-111 | 3 | 1 |
| β-strand | 114-118 | 5 | 1 |
| β-strand | 123 | 1 | 2 |
| α-helix | 127-135 | 9 | |
| β-strand | 139-141 | 3 | 1 |
| α-helix | 149-153 | 5 | |
| β-strand | 161-164 | 4 | 3 |
| β-strand | 167-168 | 2 | 4 |
| β-strand | 174-176 | 3 | 4 |
| β-strand | 179-182 | 4 | 4 |
| β-strand | 185 | 1 | 3 |
| β-strand | 193-196 | 4 | 3 |
| β-strand | 203-204 | 2 | 3 |
| β-strand | 212 | 1 | 2 |
| β-strand | 214 | 1 | 3 |
| β-strand | 215-219 | 5 | 1 |
| α-helix | 220-221 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 91-93 | 3 | |
| β-strand | 109-111 | 3 | 5 |
| β-strand | 114-118 | 5 | 5 |
| β-strand | 123 | 1 | 6 |
| α-helix | 127-135 | 9 | |
| β-strand | 139-141 | 3 | 5 |
| α-helix | 143-145 | 3 | |
| α-helix | 149-153 | 5 | |
| β-strand | 161-164 | 4 | 7 |
| β-strand | 167-168 | 2 | 8 |
| β-strand | 174-175 | 2 | 8 |
| β-strand | 182 | 1 | 8 |
| β-strand | 185 | 1 | 7 |
| β-strand | 193-196 | 4 | 7 |
| β-strand | 203-204 | 2 | 7 |
| β-strand | 212 | 1 | 6 |
| β-strand | 214 | 1 | 7 |
| β-strand | 215-219 | 5 | 5 |
| α-helix | 220-221 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glycoprotein gp42 | A, B | protein | 191 | Human herpesvirus 4 (strain B95-8) | P03205 (AlphaFold model) |
>3FD4_1 Glycoprotein gp42 (chains A, B) GGGRVAAAAITWVPKPNVEVWPVDPPPPVNFNKTAEQEYGDKEVKLPHWTPTLHTFQVPQ NYTKANCTYCNTREYTFSYKGCCFYFTKKKHTWNGCFQACAELYPCTYFYGPTPDILPVV TRNLNAIESLWVGVYRVGEGNWTSLDGGTFKVYQIFGSHCTYVSKFSTVPVSHHECSFLK PCLCVSQRSNS
Structure of Epstein-Barr virus glycoprotein 42 suggests a mechanism for triggering receptor-activated virus entry. Kirschner, A.N., Sorem, J., Longnecker, R. et al. Structure (2009) 17:223-233. DOI 10.1016/j.str.2008.12.010 · PubMed
Other PDB entries of the same protein (UniProt P03205 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3FD4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.