3FH6: Resting state maltose transporter from E. coli

Crystal structure of the resting state maltose transporter from E. coli. Determined by X-ray diffraction at 4.5 Å resolution. Released 3 Mar 2009.

Method: X-ray diffraction
Resolution: 4.5 Å
Organism: Escherichia coli
Chains: 8
Atoms: 20,236
Mol. weight: 339.42 kDa
Released: 3 Mar 2009

Explore 3FH6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FH6 contains 120 α-helices and 118 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 9 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	1
β-strand	13	1	2
β-strand	16	1	2
β-strand	22-24	3	1
β-strand	32-35	4	3
α-helix	42-50	9
β-strand	57-62	6	1
β-strand	66	1	1
α-helix	92-101	10
α-helix	107-120	14
α-helix	125-127	3
α-helix	136-150	15
β-strand	158	1	4
α-helix	166-183	18
β-strand	190	1	4
α-helix	194-200	7
β-strand	203-207	5	3
β-strand	212-216	5	3
α-helix	218-222	5
β-strand	227	1	5
α-helix	228-233	6
β-strand	241-243	3	6
β-strand	256-257	2	7
β-strand	265-266	2	7
β-strand	282-284	3	6
β-strand	291	1	8
β-strand	301-304	4	9
β-strand	314-315	2	10
β-strand	318-319	2	9
β-strand	330-331	2	10
β-strand	342-344	3	9
β-strand	346	1	8
β-strand	355	1	6
β-strand	360	1	5
β-strand	361	1	6

Chains B and D: 15 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	11
β-strand	13	1	12
β-strand	16	1	12
β-strand	20-24	5	11
β-strand	32-35	4	13
α-helix	42-50	9
β-strand	57-62	6	11
α-helix	67-69	3
α-helix	73-75	3
β-strand	77-79	3	14
α-helix	92-96	5
α-helix	99-103	5
α-helix	107-120	14
α-helix	125-127	3
α-helix	136-150	15
β-strand	154-156	3	14
β-strand	158	1	15
α-helix	160-162	3
α-helix	166-183	18
β-strand	190	1	15
α-helix	194-200	7
β-strand	203-206	4	13
β-strand	214-216	3	13
α-helix	218-223	6
β-strand	227	1	16
α-helix	228-233	6
α-helix	238-239	2
β-strand	240	1	17
β-strand	249-250	2	18
β-strand	253-254	2	18
β-strand	256	1	19
β-strand	266	1	19
β-strand	270	1	20
β-strand	282-284	3	21
β-strand	285	1	17
β-strand	291	1	22
β-strand	301-306	6	23
β-strand	314	1	24
β-strand	317-319	3	23
α-helix	326	1
β-strand	327	1	23
β-strand	331	1	24
β-strand	342-344	3	23
β-strand	346	1	22
β-strand	353-355	3	21
β-strand	360	1	16
β-strand	361	1	21
β-strand	364	1	20

Chains F and H: 20 helices, 0 β-strands

Element	Residues	Length
α-helix	42-55	14
α-helix	68-74	7
α-helix	75-80	6
α-helix	81-87	7
α-helix	102-110	9
α-helix	265-268	4
α-helix	276-306	31
α-helix	314-326	13
α-helix	330-339	10
α-helix	346-354	9
α-helix	365-394	30
α-helix	397-406	10
α-helix	411-412	2
α-helix	413-418	6
α-helix	423-438	16
α-helix	441-447	7
α-helix	451	1
α-helix	453	1
α-helix	467-473	7
α-helix	487-507	21

Chains G and I: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	9-26	18
α-helix	29-35	7
α-helix	81-111	31
α-helix	118-129	12
α-helix	136-150	15
α-helix	159-166	8
α-helix	167-169	3
α-helix	170-183	14
α-helix	187-194	8
α-helix	199-201	3
α-helix	202-207	6
α-helix	212-227	16
α-helix	231-236	6
α-helix	245-248	4
α-helix	249-251	3
α-helix	260-283	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose transport system permease protein malF	F, H	protein	480	Escherichia coli	P02916 (AlphaFold model)
Maltose transport system permease protein malG	G, I	protein	296	Escherichia coli	P68183 (AlphaFold model)
Maltose/maltodextrin import ATP-binding protein malK	A, B, C, D	protein	381	Escherichia coli	P68187 (AlphaFold model)

Sequence of entity 1 (F, H), FASTA

>3FH6_1 Maltose transport system permease protein malF (chains F, H)
MAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNY
SSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGE
QKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLD
GDGTLTNNQSGVKYRPNNQIGFYQSITADGNWGDEKLSPGYTVTTGWKNFTRVFTDEGIQ
KPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISIL
IFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKA
IPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDR
LGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVNLKATRMKFD

Sequence of entity 2 (G, I), FASTA

>3FH6_2 Maltose transport system permease protein malG (chains G, I)
MAMVQPKSQKARLFITHLLLLLFIAAIMFPLLMVVAISLRQGNFATGSLIPEQISWDHWK
LALGFSVEQADGRITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKAT
LLKGMLIFQMFPAVLSLVALYALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGY
FETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDV
NSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLLAQRWLVNGLTAGGVKG

Sequence of entity 3 (A, B, C, D), FASTA

>3FH6_3 Maltose/maltodextrin import ATP-binding protein malK (chains A, B, C, D)
MASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDL
FIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEV
LQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLH
KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMN
FLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVIL
EGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGT
ACRRLHKEPGVASASHHHHHH

Primary citation

Alternating access in maltose transporter mediated by rigid-body rotations. Khare, D., Oldham, M.L., Orelle, C. et al. Mol Cell (2009) 33:528-536. DOI 10.1016/j.molcel.2009.01.035 · PubMed

Other PDB entries of the same protein (UniProt P02916 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RLF 2.2 Å, Crystal structure of the maltose-binding protein/maltose transporter complex in an…
3PUW 2.3 Å, Crystal Structure of an outward-facing MBP-Maltose transporter complex bound to ADP-AlF4
3PUX 2.3 Å, Crystal Structure of an outward-facing MBP-Maltose transporter complex bound to ADP-BeF3
4KI0 2.38 Å, Crystal structure of the maltose-binding protein/maltose transporter complex in an…
3PUV 2.4 Å, Crystal Structure of an outward-facing MBP-Maltose transporter complex bound to ADP-VO4
2R6G 2.8 Å, The Crystal Structure of the E. coli Maltose Transporter
3PUZ 2.9 Å, Crystal Structure of a pre-translocation state MBP-Maltose transporter complex bound to…
4KHZ 2.9 Å, Crystal structure of the maltose-binding protein/maltose transporter complex in an…
3PUY 3.1 Å, Crystal Structure of an outward-facing MBP-Maltose transporter complex bound to AMP-PNP…
3PV0 3.1 Å, Crystal Structure of a pre-translocation state MBP-Maltose transporter complex without…
9BCR 3.26 Å, Cryo-EM structure of a bacterial prototype ATP-binding cassette transporter MalFGK2.
9NQJ 3.34 Å, Cryo-EM structure of a bacterial prototype ATP-binding cassette transporter MalFGK2.

Browse structure collections

About this viewer

MolViewer shows 3FH6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.