3FHI: PDB entry 3FHI

Crystal structure of a complex between the catalytic and regulatory (RI{alpha}) subunits of PKA. Determined by X-ray diffraction at 2.0 Å resolution. Released 14 Apr 2009.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Mus musculus, Bos taurus
Chains: 2
Atoms: 4,034
Mol. weight: 58.58 kDa
Ligands: ANP, MN
Released: 14 Apr 2009

Explore 3FHI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FHI contains 24 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	14-31	18
α-helix	40-42	3
β-strand	43-51	9	1
β-strand	56-62	7	1
β-strand	68-75	8	1
α-helix	76-81	6
α-helix	85-97	13
β-strand	103	1	2
β-strand	106-111	6	1
β-strand	115-121	7	1
α-helix	122	1
β-strand	127	1	2
α-helix	128-135	8
α-helix	140-159	20
β-strand	162-163	2	3
α-helix	169-171	3
β-strand	172-174	3	2
β-strand	180-182	3	2
β-strand	189-190	2	3
β-strand	195	1	4
β-strand	199-200	2	5
α-helix	202-204	3
α-helix	207-210	4
β-strand	215	1	4
α-helix	219-233	15
α-helix	243-252	10
α-helix	263-272	10
α-helix	277-279	3
α-helix	289-292	4
α-helix	295-297	3
α-helix	302-306	5
α-helix	311-312	2

Chain B: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	93-97	5
β-strand	98-99	2	5
α-helix	105-108	4
α-helix	120-129	10
α-helix	141-150	10
β-strand	152-156	5	6
β-strand	161-163	3	7
β-strand	168	1	8
β-strand	171-177	7	6
β-strand	180-184	5	7
β-strand	187-192	6	7
β-strand	197-198	2	6
α-helix	200-203	4
β-strand	208	1	8
β-strand	212-215	4	7
β-strand	219-225	7	6
α-helix	226-239	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cAMP-dependent protein kinase catalytic subunit alpha	A	protein	350	Mus musculus	P05132 (AlphaFold model)
cAMP-dependent protein kinase type I-alpha regulatory subunit	B	protein	154	Bos taurus	P00514 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3FHI_1 cAMP-dependent protein kinase catalytic subunit alpha (chains A)
GNAAAAKKGSEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLV
KHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVM
EYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYI
QVTDFGFAKRVKGRTWTLAGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFA
DQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATT
DWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF

Sequence of entity 2 (B), FASTA

>3FHI_2 cAMP-dependent protein kinase type I-alpha regulatory subunit (chains B)
GRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDA
MFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRA
ATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMY

Ligands and cofactors

ID	Name	Formula	Copies
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	1
MN	Manganese (II) ion	Mn	2

Primary citation

Crystal structure of a complex between the catalytic and regulatory (RIalpha) subunits of PKA. Kim, C., Xuong, N.H., Taylor, S.S. Science (2005) 307:690-696. DOI 10.1126/science.1104607 · PubMed

Other PDB entries of the same protein (UniProt P05132 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1RDQ 1.26 Å, Hydrolysis of ATP in the crystal of Y204A mutant of cAMP-dependent protein kinase
4DFX 1.35 Å, Crystal structure of myristoylated K7C catalytic subunit of cAMP-dependent protein…
4HPU 1.55 Å, Crystal structure of the catalytic subunit of cAMP-dependent protein kinase displaying…
4IAI 1.55 Å, X-ray Structure of cAMP dependent protein kinase A in complex with high Ca2+…
9PC1 1.55 Å, Co-crystal structure of the cAMP-dependent protein kinase catalytic subunit alpha with…
3FJQ 1.6 Å, Crystal structure of cAMP-dependent protein kinase catalytic subunit alpha in complex…
4IAK 1.6 Å, Low temperature X-ray structure of cAMP dependent protein kinase A in complex with high…
3IDB 1.62 Å, Crystal structure of (108-268)RIIb:C holoenzyme of cAMP-dependent protein kinase
4IB1 1.63 Å, Structure of cAMP dependent protein kinase A in complex with high K+ concentration, ADP…
7V0G 1.63 Å, Structure of cAMP-dependent protein kinase using a MD-MX procedure, produced using 1.63…
3QAL 1.7 Å, Crystal Structure of Arg280Ala mutant of Catalytic subunit of cAMP-dependent Protein…
3X2W 1.7 Å, Michaelis complex of cAMP-dependent Protein Kinase Catalytic Subunit

Browse structure collections

About this viewer

MolViewer shows 3FHI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.