3FLG: DNA-methyltransferase 3B

Name: PDB 3FLG: The PWWP domain of Human DNA (cytosine-5-)-methyltransferase 3 beta
Published: 2009-03-31
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

The PWWP domain of Human DNA (cytosine-5-)-methyltransferase 3 beta. Determined by X-ray diffraction at 1.8 Å resolution. Released 31 Mar 2009.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,183
Mol. weight: 16.76 kDa
Released: 31 Mar 2009

Explore 3FLG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FLG contains 7 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	24-27	4	1
β-strand	35-40	6	1
α-helix	42-45	4
α-helix	49-51	3
β-strand	54-59	6	1
β-strand	65-69	5	1
β-strand	74-75	2	1
α-helix	79-82	4
α-helix	85-90	6
α-helix	92-109	18
α-helix	121-133	13
α-helix	141-144	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (cytosine-5)-methyltransferase 3B	A	protein	151	Homo sapiens	Q9UBC3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3FLG_1 DNA (cytosine-5)-methyltransferase 3B (chains A)
GEADSGDGDSSEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWF
GDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDS
LEDQLKPMLEWAHGGFKPTGIEGLKPNNTQP

Primary citation

Crystal Structure of the PWWP domain of Human DNA (cytosine-5-)-methyltransferase 3 beta. Zeng, H., Amaya, M.F., MacKenzie, F. et al. To be published.

Other PDB entries of the same protein (UniProt Q9UBC3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NRR 1.7 Å, Human DNMT3B PWWP domain in complex with 5-[(2-Hydroxyethyl)(propyl)amino]-1-pentanol
5NV2 2.03 Å, Human DNMT3B PWWP domain in complex with N-isopropyl-1,5-dimethylhexylamine (Metron S)
3QKJ 2.04 Å, The PWWP domain of human DNA (CYTOSINE-5-)-METHYLTRANSFERASE 3 BETA in complex with a…
5NRV 2.08 Å, Human DNMT3B PWWP domain in complex with 6-dipropylamino-1-hexanol
7O45 2.1 Å, Crystal structure of ADD domain of the human DNMT3B methyltransferase
5CIU 2.24 Å, Structural basis of the recognition of H3K36me3 by DNMT3B PWWP domain
6R3E 2.27 Å, Human DNMT3B PWWP domain in complex with triisopropanolamine
5NR3 2.3 Å, Human DNMT3B PWWP domain in complex with ethambutol
5NRS 2.3 Å, Human DNMT3B PWWP domain in complex with N,N-bis(2-hydroxypropyl)ethanolamine
5NV0 2.4 Å, Human DNMT3B PWWP domain in complex with 4-(dipropylamino)butyronitrile
5NVO 2.4 Å, Human DNMT3B PWWP domain in complex with choline
5NV7 2.57 Å, Human DNMT3B PWWP domain in complex with N1-(2-hydroxyethyl)-2-methyl-1,2-propanediamine

Browse structure collections

About this viewer

MolViewer shows 3FLG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.