Anionic trypsin variant S195A in complex with bovine pancreatic trypsin inhibitor (BPTI) cleaved at the scissile bond (LYS15-ALA16) determined to the 1.46 A resolution limit. Determined by X-ray diffraction at 1.46 Å resolution. Released 17 Feb 2009.
Explore 3FP7 in 3D Show helices and sheets RCSB PDB PDBe
3FP7 contains 12 α-helices and 24 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 1 |
| β-strand | 20-21 | 2 | 2 |
| α-helix | 22-23 | 2 | |
| β-strand | 30-34 | 5 | 3 |
| β-strand | 40-48 | 9 | 3 |
| β-strand | 51-54 | 4 | 3 |
| α-helix | 56-58 | 3 | |
| β-strand | 64-68 | 4 | 3 |
| β-strand | 72 | 1 | 4 |
| β-strand | 81-90 | 10 | 3 |
| β-strand | 104-108 | 5 | 3 |
| β-strand | 115 | 1 | 5 |
| β-strand | 118 | 1 | 5 |
| β-strand | 122 | 1 | 2 |
| α-helix | 123-124 | 2 | |
| α-helix | 128-130 | 3 | |
| β-strand | 135-140 | 6 | 2 |
| β-strand | 154 | 1 | 4 |
| α-helix | 155 | 1 | |
| β-strand | 156-162 | 7 | 2 |
| α-helix | 163-164 | 2 | |
| α-helix | 165-171 | 7 | |
| β-strand | 180-183 | 4 | 2 |
| β-strand | 189 | 1 | 1 |
| β-strand | 198-201 | 4 | 2 |
| β-strand | 204-215 | 8 | 2 |
| β-strand | 226-230 | 5 | 2 |
| α-helix | 231-233 | 3 | |
| α-helix | 235-244 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-6 | 4 | |
| α-helix | 8-9 | 2 | |
| β-strand | 14 | 1 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 18-24 | 7 | 6 |
| β-strand | 29-35 | 7 | 6 |
| β-strand | 45 | 1 | 6 |
| α-helix | 48-55 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Anionic trypsin-2 | E | protein | 223 | Rattus norvegicus | P00763 (AlphaFold model) |
| Pancreatic trypsin inhibitor | I | protein | 15 | P00974 (AlphaFold model) | |
| Pancreatic trypsin inhibitor | J | protein | 43 | P00974 (AlphaFold model) |
>3FP7_1 Anionic trypsin-2 (chains E) IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEG NEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISG WGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDAGGP VVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
>3FP7_2 Pancreatic trypsin inhibitor (chains I) RPDFCLEPPYTGPCK
>3FP7_3 Pancreatic trypsin inhibitor (chains J) ARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCGGA
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
Water and common crystallization additives (SO4, PG4, EDO) are not listed.
Structure of a serine protease poised to resynthesize a peptide bond. Zakharova, E., Horvath, M.P., Goldenberg, D.P. Proc Natl Acad Sci U S A (2009) 106:11034-11039. DOI 10.1073/pnas.0902463106 · PubMed
Other PDB entries of the same protein (UniProt P00763 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3FP7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.