The crystallographic structure of the Complex between Evasin-1 and CCL3. Determined by X-ray diffraction at 1.76 Å resolution. Released 12 Jan 2010.
Explore 3FPU in 3D Show helices and sheets RCSB PDB PDBe
3FPU contains 11 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-13 | 2 | |
| β-strand | 14-15 | 2 | 1 |
| β-strand | 16-18 | 3 | 2 |
| β-strand | 24-26 | 3 | 2 |
| β-strand | 30-33 | 4 | 3 |
| β-strand | 36-39 | 4 | 3 |
| α-helix | 40-41 | 2 | |
| β-strand | 45-47 | 3 | 2 |
| α-helix | 50-56 | 7 | |
| α-helix | 58 | 1 | |
| β-strand | 63-71 | 9 | 2 |
| β-strand | 74-85 | 12 | 2 |
| β-strand | 88 | 1 | 4 |
| α-helix | 89-92 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-6 | 3 | |
| β-strand | 8 | 1 | 4 |
| α-helix | 9 | 1 | |
| β-strand | 10-11 | 2 | 1 |
| α-helix | 19-21 | 3 | |
| α-helix | 22-24 | 3 | |
| β-strand | 25-30 | 6 | 5 |
| α-helix | 31-32 | 2 | |
| β-strand | 40-44 | 5 | 5 |
| β-strand | 49-52 | 4 | 5 |
| α-helix | 57-65 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Evasin-1 | A | protein | 100 | Rhipicephalus sanguineus | P0C8E7 (AlphaFold model) |
| C-C motif chemokine 3 | B | protein | 70 | Homo sapiens | P10147 (AlphaFold model) |
>3FPU_1 Evasin-1 (chains A) EDDEDYGDLGGCPFLVAENKTGYPTIVACKQDCNGTTETAPNGTRCFSIGDEGLRRMTAN LPYDCPLGQCSNGDCIPKETYEVCYRRNWRDKKNHHHHHH
>3FPU_2 C-C motif chemokine 3 (chains B) MSLAADTPTTCCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQ KYVSDLELSA
| ID | Name | Formula | Copies |
|---|---|---|---|
| NI | Nickel (II) ion | Ni | 2 |
Structural basis of chemokine sequestration by a tick chemokine binding protein: the crystal structure of the complex between Evasin-1 and CCL3. Dias, J.M., Losberger, C., Deruaz, M. et al. PLoS One (2009) 4. DOI 10.1371/journal.pone.0008514 · PubMed
Other PDB entries of the same protein (UniProt P0C8E7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3FPU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.