3FSH: Ubiquitin conjugating enzyme Ube2g2

Name: PDB 3FSH: Crystal structure of the ubiquitin conjugating enzyme Ube2g2 bound to the G2BR domain of ubiquitin ligase gp78
Published: 2009-02-10
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Crystal structure of the ubiquitin conjugating enzyme Ube2g2 bound to the G2BR domain of ubiquitin ligase gp78. Determined by X-ray diffraction at 2.76 Å resolution. Released 10 Feb 2009.

Method: X-ray diffraction
Resolution: 2.76 Å
Organism: Mus musculus
Chains: 3
Atoms: 2,862
Mol. weight: 41.18 kDa
Released: 10 Feb 2009

Explore 3FSH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FSH contains 15 α-helices and 14 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	0-18	19
β-strand	24-28	5	1
β-strand	36-42	7	1
α-helix	43-44	2
β-strand	53-59	7	1
β-strand	70-73	4	1
β-strand	82	1	2
β-strand	87	1	1
β-strand	88	1	2
α-helix	91-93	3
α-helix	116-128	13
α-helix	132-134	3
α-helix	138-145	8
α-helix	148-162	15

Chain B: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	0-18	19
α-helix	20-21	2
β-strand	24-28	5	3
β-strand	36-42	7	3
α-helix	43-44	2
β-strand	53-59	7	3
β-strand	70-73	4	3
β-strand	82	1	4
β-strand	87	1	3
β-strand	88	1	4
α-helix	91-93	3
α-helix	116-126	11
α-helix	138-145	8
α-helix	148-163	16

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	582-597	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-conjugating enzyme E2 G2	A, B	protein	168	Mus musculus	P60605 (AlphaFold model)
Autocrine motility factor receptor, isoform 2	C	protein	28		Q9UKV5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3FSH_1 Ubiquitin-conjugating enzyme E2 G2 (chains A, B)
GSHMAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAI
LSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVE
KILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL

Sequence of entity 2 (C), FASTA

>3FSH_2 Autocrine motility factor receptor, isoform 2 (chains C)
SADERQRMLVQRKDELLQQARKRFLNKS

Primary citation

Mechanistic insights into active site-associated polyubiquitination by the ubiquitin-conjugating enzyme Ube2g2. Li, W., Tu, D., Li, L. et al. Proc Natl Acad Sci U S A (2009) 106:3722-3727. DOI 10.1073/pnas.0808564106 · PubMed

Browse structure collections

About this viewer

MolViewer shows 3FSH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.