The Crystal structure of receptor binding domain of botulinum neurotoxin serotype A. Determined by X-ray diffraction at 1.8 Å resolution. Released 16 Jun 2009.
Explore 3FUO in 3D Show helices and sheets RCSB PDB PDBe
3FUO contains 7 α-helices and 46 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 878-879 | 2 | 1 |
| β-strand | 880-882 | 3 | 2 |
| β-strand | 887-889 | 3 | 2 |
| β-strand | 896-899 | 4 | 3 |
| β-strand | 904-905 | 2 | 1 |
| β-strand | 913-916 | 4 | 1 |
| β-strand | 923-926 | 4 | 3 |
| α-helix | 929-931 | 3 | |
| β-strand | 934-935 | 2 | 4 |
| β-strand | 940-947 | 8 | 1 |
| α-helix | 948-951 | 4 | |
| α-helix | 954-956 | 3 | |
| β-strand | 961-967 | 7 | 3 |
| β-strand | 972-978 | 7 | 3 |
| β-strand | 981-987 | 7 | 3 |
| β-strand | 993-999 | 7 | 3 |
| β-strand | 1003 | 1 | 5 |
| β-strand | 1014-1020 | 7 | 1 |
| β-strand | 1025-1030 | 6 | 1 |
| β-strand | 1033-1039 | 7 | 1 |
| β-strand | 1046-1047 | 2 | 4 |
| β-strand | 1051-1057 | 7 | 3 |
| β-strand | 1065-1074 | 10 | 1 |
| α-helix | 1080-1089 | 10 | |
| β-strand | 1095 | 1 | 6 |
| β-strand | 1097 | 1 | 7 |
| β-strand | 1103 | 1 | 7 |
| α-helix | 1104 | 1 | |
| β-strand | 1105 | 1 | 8 |
| β-strand | 1110 | 1 | 9 |
| β-strand | 1111-1114 | 4 | 10 |
| β-strand | 1121-1124 | 4 | 9 |
| β-strand | 1133-1136 | 4 | 9 |
| β-strand | 1141-1144 | 4 | 5 |
| β-strand | 1148-1151 | 4 | 5 |
| β-strand | 1159-1163 | 5 | 9 |
| β-strand | 1172 | 1 | 8 |
| β-strand | 1174 | 1 | 6 |
| β-strand | 1178-1184 | 7 | 9 |
| β-strand | 1189-1193 | 5 | 9 |
| β-strand | 1194 | 1 | 11 |
| β-strand | 1203-1204 | 2 | 9 |
| β-strand | 1206-1208 | 3 | 9 |
| α-helix | 1210-1212 | 3 | |
| β-strand | 1217 | 1 | 11 |
| β-strand | 1219-1225 | 7 | 9 |
| β-strand | 1231-1233 | 3 | 9 |
| β-strand | 1234 | 1 | 10 |
| β-strand | 1235-1239 | 5 | 9 |
| β-strand | 1245-1254 | 10 | 9 |
| β-strand | 1257-1263 | 7 | 9 |
| α-helix | 1264-1271 | 8 | |
| β-strand | 1281-1284 | 4 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Botulinum neurotoxin type A | A | protein | 426 | Clostridium botulinum | P0DPI1 (AlphaFold model) |
>3FUO_1 Botulinum neurotoxin type A (chains A) KNIINTSILNLRYESNHLIDLSRYASKINIGSKVNFDPIDKNQIQLFNLESSKIEVILKN AIVYNSMYENFSTSFWIRIPKYFNSISLNNEYTIINCMENNSGWKVSLNYGEIIWTLQDT QEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYINGRLIDQKPISNLGNIHAS NNIMFKLDGCRDTHRYIWIKYFNLFDKELNEKEIKDLYDNQSNSGILKDFWGDYLQYDKP YYMLNLYDPNKYVDVNNVGIRGYMYLKGPRGSVMTTNIYLNSSLYRGTKFIIKKYASGNK DNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMKSKNDQG ITNKCKMNLQDNNGNDIGFIGFHQFNNIAKLVASNWYNRQIERSSRTLGCSWEFIPVDDG WGERPL
Glycosylated SV2 and gangliosides as dual receptors for botulinum neurotoxin serotype F. Fu, Z., Chen, C., Barbieri, J.T. et al. Biochemistry (2009) 48:5631-5641. DOI 10.1021/bi9002138 · PubMed
Other PDB entries of the same protein (UniProt P0DPI1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3FUO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.