3G3Q: Eukaryotic polyphosphate polymerase

Crystal structure of a eukaryotic polyphosphate polymerase in complex with a phosphate polymer. Determined by X-ray diffraction at 2.64 Å resolution. Released 5 May 2009.

Method: X-ray diffraction
Resolution: 2.64 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 4,939
Mol. weight: 72.59 kDa
Ligands: PO4
Released: 5 May 2009

Explore 3G3Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3G3Q contains 30 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 15 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	194-203	10	1
α-helix	205-218	14
α-helix	220	1
β-strand	221	1	1
α-helix	222	1
α-helix	229-230	2
α-helix	232-235	4
β-strand	236-243	8	1
α-helix	248-255	8
β-strand	261-268	8	1
β-strand	275-282	8	1
α-helix	286-288	3
β-strand	293-300	8	1
α-helix	301-303	3
α-helix	304-309	6
α-helix	314-322	9
α-helix	329-348	20
β-strand	352-364	13	1
β-strand	372-384	13	1
α-helix	414-416	3
β-strand	417-419	3	1
β-strand	423-432	10	1
α-helix	439-445	7
β-strand	451-452	2	1
α-helix	458-466	9
α-helix	468-470	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vacuolar transporter chaperone 4	A, B	protein	295	Saccharomyces cerevisiae	P47075 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3G3Q_1 Vacuolar transporter chaperone 4 (chains A, B)
GAMGKQQNFVRQTTKYWVHPDNITELKLIILKHLPVLVFNTNKEFEREDSAITSIYFDNE
NLDLYYGRLRKDEGAEAHRLRWYGGMSTDTIFVERKTHREDWTGEKSVKARFALKERHVN
DFLKGKYTVDQVFAKMRKEGKKPMNEIENLEALASEIQYVMLKKKLRPVVRSFYNRTAFQ
LPGDARVRISLDTELTMVREDNFDGVDRTHKNWRRTDIGVDWPFKQLDDKDICRFPYAVL
EVKLQTQLGQEPPEWVRELVGSHLVEPVPKFSKFIHGVATLLNDKVDSIPFWLPQ

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	29

Water and common crystallization additives (SO4) are not listed.

Primary citation

Catalytic core of a membrane-associated eukaryotic polyphosphate polymerase. Hothorn, M., Neumann, H., Lenherr, E.D. et al. Science (2009) 324:513-516. DOI 10.1126/science.1168120 · PubMed

Other PDB entries of the same protein (UniProt P47075 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3G3T 1.85 Å, Crystal structure of a eukaryotic polyphosphate polymerase in complex with orthophosphate
3G3R 2.0 Å, Crystal structure of a eukaryotic polyphosphate polymerase in complex with AppNHp-Mn2+
3G3U 2.07 Å, Crystal structure of a eukaryotic polyphosphate polymerase in complex with pyrophosphate
5IIT 2.13 Å, Structure of SPX domain of the yeast inorganic polyphophate polymerase Vtc4 crystallized…
5IIG 2.99 Å, Structure of the SPX-TTM domain fragment of the yeast inorganic polyphophate polymerase…
7YTJ 3.0 Å, Cryo-EM structure of VTC complex
5IIQ 3.03 Å, Structure of the SPX-TTM domain fragment of the yeast inorganic polyphophate polymerase…
9UMG 3.04 Å, Cryo-EM structure of VTC complex(Vtc5/Vtc4/Vtc3/Vtc1)
8I6V 3.06 Å, Cryo-EM structure of the polyphosphate polymerase VTC complex(Vtc4/Vtc3/Vtc1)
5LNC 3.29 Å, Structure of SPX domain of the yeast inorganic polyphophate polymerase Vtc4 crystallized…

Browse structure collections

About this viewer

MolViewer shows 3G3Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.